DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment gbb and Gdf1

DIOPT Version :9

Sequence 1:	NP_001286786.1	Gene:	gbb / 37778	FlyBaseID:	FBgn0024234	Length:	455	Species:	Drosophila melanogaster
Sequence 2:	NP_001156754.1	Gene:	Gdf1 / 14559	MGIID:	95683	Length:	357	Species:	Mus musculus

Alignment Length:	130	Identity:	46/130 - (35%)
Similarity:	71/130 - (54%)	Gaps:	11/130 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   330 PRKRKKSVSPNNVPLLEPMESTRSCQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGECNFPLNAH 394
            ||.|:     :..|.:| :....:|:.:.|::.|:::|||.|:|||.|:.|.:|.|.|..|....
Mouse   233 PRLRR-----HTEPRVE-VGPVGTCRTRRLHVSFREVGWHRWVIAPRGFLANFCQGTCALPETLR 291

  Fly   395 ----MNATNHAIVQTLVHLLEPKK-VPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
                ..|.|||:::.|:|...|.. ...|||.|.||..:.||:..|.:||.|:.|.:|:|..|||
Mouse   292 GPGGPPALNHAVLRALMHAAAPTPGAGSPCCVPERLSPISVLFFDNSDNVVLRHYEDMVVDECGC 356

Fly 455 454
Mouse 357 356

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
gbb	NP_001286786.1	TGFb_propeptide	44..305	CDD:279078
gbb	NP_001286786.1	TGFB	354..455	CDD:214556	41/106 (39%)
Gdf1	NP_001156754.1	TGFb_propeptide	36..>141	CDD:279078
Gdf1	NP_001156754.1	TGFB	251..357	CDD:214556	41/106 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910