DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and Bmp2

DIOPT Version :10

Sequence 1:NP_477340.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_031579.2 Gene:Bmp2 / 12156 MGIID:88177 Length:394 Species:Mus musculus


Alignment Length:98 Identity:24/98 - (24%)
Similarity:33/98 - (33%) Gaps:18/98 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   916 SGEKRRRHTIPKVVSA-------------THTM-NGTPRQRVRRVACTCPNCEVKSSGPPDRKRQ 966
            ||.|....::|.:..|             .|.| ||...:....::|.. |.| :.|....|:.|
Mouse   244 SGAKHNFTSLPPIQLACPEPALATVDGFCMHGMKNGATSEEFSALSCLL-NRE-RRSASIFRREQ 306

  Fly   967 HICHVSGCNKVYGKTSHLRAHLRWHTGERPFIC 999
            ......|.  :.|..|.........|..|||||
Mouse   307 KAATTLGV--IMGVFSFCWLPFFLFTTARPFIC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_477340.1 TGFb_propeptide 45..305 CDD:459906
TGF_beta_BMP5_like 353..455 CDD:381639
Bmp2NP_031579.2 TGFb_propeptide 45..265 CDD:459906 5/20 (25%)
TGF_beta_BMP2 292..394 CDD:381660 14/50 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.