DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and Bmp15

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_033887.1 Gene:Bmp15 / 12155 MGIID:1316745 Length:392 Species:Mus musculus


Alignment Length:246 Identity:66/246 - (26%)
Similarity:97/246 - (39%) Gaps:40/246 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 GQHTMEPLSSVNTTGDYVGWLELNVTEGLHEWLVKSKDNHGIYIGAHAVNRPDREVK-------- 283
            |.....|:|.        .|.|:::|..:.:.|...|....:.:......:...|.:        
Mouse   168 GSSKPSPMSK--------AWTEIDITHCIQQKLWNRKGRSVLRLRFMCQQQKGNETREFRWHGMT 224

  Fly   284 -LDDIGLI--HRKVDDEFQPFMIGFFRGPELIKATAHSSHHRSKR-------SASHPRKRKKSVS 338
             ||...|:  ....||..|..::.  ||.|.:.....|...||.|       .||.| .::...|
Mouse   225 SLDVAFLLLYFNDTDDRVQGKLLA--RGQEELTDRESSFLMRSVRQACSIESDASCP-SQEHDGS 286

  Fly   339 PNNVPLLEPMESTRSCQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGECNFPLNAHMNATNHAIV 403
            .||           .|.:....:.|..|||..|||||..|...||.|.|...|...:|:.||||:
Mouse   287 VNN-----------QCSLHPYKVSFHQLGWDHWIIAPRLYTPNYCKGICTRVLPYGLNSPNHAII 340

  Fly   404 QTLVHLLEPKKVPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            |:||:.|....||:|.|.|.....:.:|....:.::..|:|..||.:||.|
Mouse   341 QSLVNELVNHSVPQPSCVPYNFLPMSILLIETNGSILYKEYEGMIAQSCTC 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 15/88 (17%)
TGFB 354..455 CDD:214556 38/101 (38%)
Bmp15NP_033887.1 TGF_beta 289..391 CDD:278448 38/112 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.