DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and Bmp3

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001297606.1 Gene:Bmp3 / 110075 MGIID:88179 Length:470 Species:Mus musculus


Alignment Length:288 Identity:71/288 - (24%)
Similarity:113/288 - (39%) Gaps:78/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 ITDLDKRAIDESDIIMTFLNKRHHNVDELRHEHGRRLWFDVSNVPNDNYLVMA-ELRIYQNANEG 205
            ||.|.::|....:.::.|      |:....||..:|:.|    .|....||.| :..|.:..:..
Mouse   198 ITQLLRKAKQNEEFLIGF------NITSRAHELPKRMLF----FPEPYILVYANDAAISEPESVV 252

  Fly   206 KWLTANREFTITVYAIGTG-TLGQHTMEPLSSVNTTGDYVGWLELNVTEGLHEWLVKSKDNHGIY 269
            ..|..:|:||     .||| .|..|..|.||...                      :.|.:.||.
Mouse   253 SSLQRHRDFT-----AGTGPRLDSHVREALSVER----------------------RKKRSTGIL 290

  Fly   270 IGAHAVNRPDREVKLDDIGLIHRKVDDEFQPFMIGFFRGPELIKATAHSSHHRSKRSASHPR--- 331
            :.......|..|.:..:.|     ..:|.:|:.....:.||      .|.:.:.:|..||.:   
Mouse   291 LPLQNNELPGAEYQYKEEG-----AWEERKPYKSLQTQPPE------KSRNKKKQRKGSHQKGQT 344

  Fly   332 -----------KRKKSVSPNNVPLLEPMESTRSCQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSG 385
                       :||:.|.|            |:|..:.|.:||.|:||.:|||:|:.:.||||||
Mouse   345 LQFDEQTLKKARRKQWVEP------------RNCARRYLKVDFADIGWSEWIISPKSFDAFYCSG 397

  Fly   386 ECNFPLN--AHMNATNHAIVQTLVHLLE 411
            .|.||:.  |...|..|.::.:.:|.:|
Mouse   398 ACQFPMPKVAAAAAALHLVLISFLHGVE 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 35/164 (21%)
TGFB 354..455 CDD:214556 25/60 (42%)
Bmp3NP_001297606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..53
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 314..349 7/40 (18%)
TGF_beta 364..>424 CDD:278448 25/59 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.