DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and gdf9

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_002935305.1 Gene:gdf9 / 100496740 XenbaseID:XB-GENE-478149 Length:421 Species:Xenopus tropicalis


Alignment Length:243 Identity:56/243 - (23%)
Similarity:98/243 - (40%) Gaps:36/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 WLELNVTEGLHEWLVKSKDNHGIYIGAH------------AVNRPDREVK--------LDDIG-- 288
            |:|::||..|..::...:.|  |::|.:            |...|.:..:        |:|..  
 Frog   180 WVEIDVTSILQPFISNKRQN--IHLGLNFTCMKNNKHYDFATTGPFKMTRSPPSLLLYLNDTSNK 242

  Fly   289 LIHRKV--DDEFQPFMIGFFRGPELIKATAHS--SHHRSKRSASHP----RKRKKSVSPNNVPLL 345
            ..||::  |...||......|.|.::.....:  ....|:|..:|.    .:...:|.|:.....
 Frog   243 AYHRRIMHDIAEQPLYYPVGRIPSILADDEGNLKLQQMSRRRRNHDYEAILEENTTVVPHTFNFS 307

  Fly   346 EPME----STRSCQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGECNFPLNAHMNATNHAIVQTL 406
            |.::    |...|::....:.|..|.|..||:||..|...||.|.|...:.....:..|.|||.:
 Frog   308 EYLKQFVYSHNECELHRFRLSFSQLNWDKWILAPHRYSPDYCKGVCPRIVGHRYGSPVHTIVQNI 372

  Fly   407 VHLLEPKKVPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            ::......:|:|.|.|:....:.||....|.::..|:|::||...|.|
 Frog   373 IYEKVDSSIPRPSCVPSEYRPMSVLTIEPDNSIAYKEYQDMIATKCTC 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 17/82 (21%)
TGFB 354..455 CDD:214556 30/101 (30%)
gdf9XP_002935305.1 TGF_beta_GDF9 318..421 CDD:381673 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.