Sequence 1: | NP_001286784.1 | Gene: | CG5554 / 37775 | FlyBaseID: | FBgn0034914 | Length: | 330 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_012261.1 | Gene: | EPS1 / 854812 | SGDID: | S000001267 | Length: | 701 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 337 | Identity: | 73/337 - (21%) |
---|---|---|---|
Similarity: | 117/337 - (34%) | Gaps: | 111/337 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 TCAALLL--LAATAQSTAAAQSGLQPGGKLIELDEDNWHLMLQGEWMIEFFAPWCPACKNLAP-- 71
Fly 72 --TWERFARVAKDVQVQVAKIDVTTSPSLSGRFFVTALPTI-YHVKDGEFRQY-RGARDGDALLY 132
Fly 133 FVKKQQWQSIEP-----------------------------------LSAWKKPDTTHMSVLSYF 162
Fly 163 FK---LSHTLKHTQKLFK---------------DFNGRLQEEYG--------------------- 188
Fly 189 LPTWGSYALFAIATIFVGAALGLLLVCLVDFVYPPKKSQRQSFSESQ-DNLTEG-LEDLATEEI- 250
Fly 251 --EDDGDAEEND 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5554 | NP_001286784.1 | PDI_a_TMX | 36..136 | CDD:239292 | 27/105 (26%) |
EPS1 | NP_012261.1 | Thioredoxin | 33..139 | CDD:395038 | 29/113 (26%) |
PTZ00102 | <404..>472 | CDD:240266 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S2346 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |