DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5554 and EPS1

DIOPT Version :9

Sequence 1:NP_001286784.1 Gene:CG5554 / 37775 FlyBaseID:FBgn0034914 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_012261.1 Gene:EPS1 / 854812 SGDID:S000001267 Length:701 Species:Saccharomyces cerevisiae


Alignment Length:337 Identity:73/337 - (21%)
Similarity:117/337 - (34%) Gaps:111/337 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TCAALLL--LAATAQSTAAAQSGLQPGGKLIELDEDNWHLMLQGEWMIEFFAPWCPACKNLAP-- 71
            :|...||  ..|.|:........|.|.....||.        :|..:|:|::|:||.||:|||  
Yeast    14 SCITFLLKFTIAAAEPPEGFPEPLNPTNFKEELS--------KGLHIIDFYSPYCPHCKHLAPVW 70

  Fly    72 --TWERFARVAKDVQVQVAKIDVTTSPSLSGRFFVTALPTI-YHVKDGEFRQY-RGARDGDALLY 132
              |||.|...:|.:.:..::::...|..|.|...:...|.| .:...|..:.: ...|..::|:.
Yeast    71 METWEEFKEESKTLNITFSQVNCIESADLCGDENIEYFPEIRLYNPSGYIKSFTETPRTKESLIA 135

  Fly   133 FVKKQQWQSIEP-----------------------------------LSAWKKPDTTHMSVLSYF 162
            |.::   :|::|                                   :|.|...|..: |..|..
Yeast   136 FARR---ESMDPNNLDTDLDSAKSESQYLEGFDFLELIAGKATRPHLVSFWPTKDMKN-SDDSLE 196

  Fly   163 FK---LSHTLKHTQKLFK---------------DFNGRLQEEYG--------------------- 188
            ||   ..|..:.|.|:..               :.|..:.||.|                     
Yeast   197 FKNCDKCHEFQRTWKIISRQLAVDDINTGHVNCESNPTICEELGFGDLVKITNHRADREPKVALV 261

  Fly   189 LPTWGSYALFAIATIFVGAALGLLLVCLVDFVYPPKKSQRQSFSESQ-DNLTEG-LEDLATEEI- 250
            ||...|..||.....:...:.|     .|||.       |::|:.|: .|:||| ||..|..:| 
Yeast   262 LPNKTSNNLFDYPNGYSAKSDG-----YVDFA-------RRTFTNSKFPNITEGELEKKANRDID 314

  Fly   251 --EDDGDAEEND 260
              ::.|....||
Yeast   315 FLQERGRVTNND 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5554NP_001286784.1 PDI_a_TMX 36..136 CDD:239292 27/105 (26%)
EPS1NP_012261.1 Thioredoxin 33..139 CDD:395038 29/113 (26%)
PTZ00102 <404..>472 CDD:240266
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2346
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.