DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5554 and TMX1

DIOPT Version :9

Sequence 1:NP_001286784.1 Gene:CG5554 / 37775 FlyBaseID:FBgn0034914 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_110382.3 Gene:TMX1 / 81542 HGNCID:15487 Length:280 Species:Homo sapiens


Alignment Length:267 Identity:110/267 - (41%)
Similarity:163/267 - (61%) Gaps:14/267 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VAATCAALLLLAATAQSTAAAQSGLQPGGKLIELDEDNWHLMLQGEWMIEFFAPWCPACKNLAPT 72
            :|...|.|:||...|..|...:|.::      .:.::||..:|:|:|||||:|||||||:||.|.
Human     7 LAVPLAVLVLLLWGAPWTHGRRSNVR------VITDENWRELLEGDWMIEFYAPWCPACQNLQPE 65

  Fly    73 WERFARVAKDVQVQVAKIDVTTSPSLSGRFFVTALPTIYHVKDGEFRQYRGARDGDALLYFVKKQ 137
            ||.||...:|::|.:||:|||..|.|||||.:||||||||.||||||:|:|.|.....:.|:..:
Human    66 WESFAEWGEDLEVNIAKVDVTEQPGLSGRFIITALPTIYHCKDGEFRRYQGPRTKKDFINFISDK 130

  Fly   138 QWQSIEPLSAWKKPDTTHMSVLSYFFKLSHTLKHTQKLFKDFNGRLQEEYGLPTWGSYALFAIAT 202
            :|:||||:|:|..|.:..||.:|..|:||..::.....|       .|:.|||.||||.:||:||
Human   131 EWKSIEPVSSWFGPGSVLMSSMSALFQLSMWIRTCHNYF-------IEDLGLPVWGSYTVFALAT 188

  Fly   203 IFVGAALGLLLVCLVDFVYPPKKSQRQSFS-ESQDNLTEGLEDLATEEIEDDGDAEENDDEQRDS 266
            :|.|..|||.::.:.|.:.|.|:.:.|.:. .|:..|:|..:.|...|.|.:.|.|:..:|:.:|
Human   189 LFSGLLLGLCMIFVADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAES 253

  Fly   267 DEEEQED 273
            .|...:|
Human   254 KEGTNKD 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5554NP_001286784.1 PDI_a_TMX 36..136 CDD:239292 54/99 (55%)
TMX1NP_110382.3 PDI_a_TMX 29..129 CDD:239292 55/105 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 218..280 12/43 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I5084
eggNOG 1 0.900 - - E2759_KOG0913
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12482
Inparanoid 1 1.050 218 1.000 Inparanoid score I3592
Isobase 1 0.950 - 0 Normalized mean entropy S2346
OMA 1 1.010 - - QHG47726
OrthoDB 1 1.010 - - D1481386at2759
OrthoFinder 1 1.000 - - FOG0006167
OrthoInspector 1 1.000 - - otm41981
orthoMCL 1 0.900 - - OOG6_106530
Panther 1 1.100 - - LDO PTHR46107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3134
SonicParanoid 1 1.000 - - X5609
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.820

Return to query results.
Submit another query.