DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5554 and Pdia6

DIOPT Version :10

Sequence 1:NP_001286784.1 Gene:CG5554 / 37775 FlyBaseID:FBgn0034914 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_082235.2 Gene:Pdia6 / 71853 MGIID:1919103 Length:440 Species:Mus musculus


Alignment Length:124 Identity:41/124 - (33%)
Similarity:65/124 - (52%) Gaps:7/124 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALLLLAATAQSTAAAQSGL-QPGGKLIELDEDNWH---LMLQGEWMIEFFAPWCPACKNLAPTWE 74
            |.|:|...:.:...|.||| .....:|||...|::   :...|.|::||:||||..|:.|.|.|:
Mouse     2 ARLVLGLVSCTFFLAVSGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWK 66

  Fly    75 RFARVAKDVQVQVAKIDVTTSPSLSGRFFVTALPT--IYHVKDGEFRQYRGARDGDALL 131
            :.|...||| |:|..::.....||.|::.|...||  |:.....:...|:|.|.|:|::
Mouse    67 KAATALKDV-VKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIV 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5554NP_001286784.1 PDI_a_TMX 36..136 CDD:239292 34/101 (34%)
Pdia6NP_082235.2 PDI_a_P5 26..128 CDD:239299 34/100 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..161
PDI_a_P5 161..266 CDD:239299
P5_C 275..404 CDD:239281
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..440
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 437..440
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.