DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5554 and TMX4

DIOPT Version :9

Sequence 1:NP_001286784.1 Gene:CG5554 / 37775 FlyBaseID:FBgn0034914 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_066979.2 Gene:TMX4 / 56255 HGNCID:25237 Length:349 Species:Homo sapiens


Alignment Length:351 Identity:126/351 - (35%)
Similarity:188/351 - (53%) Gaps:45/351 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 AATCAALLLLAATAQSTAAA----QSGLQPGGKLIELDEDNWHLMLQGEWMIEFFAPWCPACKNL 69
            |...|.:..:||||....||    ||.:||      :...||.|:::||||::|:|||||:|:..
Human    12 ALLAAWIAAVAATAGPEEAALPPEQSRVQP------MTASNWTLVMEGEWMLKFYAPWCPSCQQT 70

  Fly    70 APTWERFARVAKDVQVQVAKIDVTTSPSLSGRFFVTALPTIYHVKDGEFRQYRGARDGDALLYFV 134
            ...||.||:..:.:|:.|.|:||...|.||||||||.||..:|.|||.||:|||....:.|..::
Human    71 DSEWEAFAKNGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIFEDLQNYI 135

  Fly   135 KKQQWQSIEPLSAWKKPDTTHMSVLSYFFKLSHTLKHTQKLFKDFNGRLQEEYGLPTWGSYALFA 199
            .:::|||:|||:.||.|.:..||.::..|.:|..:.|....|       ....|:|.|.||..|.
Human   136 LEKKWQSVEPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYF-------TVTLGIPAWCSYVFFV 193

  Fly   200 IATIFVGAALGLLLVCLVDFVYPP------KKSQRQSFSESQDNLTEGLEDLATEEIEDDGDAEE 258
            |||:..|..:||:||.:.:..|.|      ::|::...|| :.:..|.|:|  .||.:||.:.||
Human   194 IATLVFGLFMGLVLVVISECFYVPLPRHLSERSEQNRRSE-EAHRAEQLQD--AEEEKDDSNEEE 255

  Fly   259 NDDEQRDSDEEEQEDDDEEEEDSEEQVGDLATKEKEADSEPEKE----------EKPEPKQAGDA 313
            |.|...|.:||:::..||:|.:.||:..:||....|..||...:          |:.||::|.:.
Human   256 NKDSLVDDEEEKEDLGDEDEAEEEEEEDNLAAGVDEERSEANDQGPPGEDGVTREEVEPEEAEEG 320

  Fly   314 -----APEKTEQV----RKRKPRKGD 330
                 .|..||.|    |:||.:..|
Human   321 ISEQPCPADTEVVEDSLRQRKSQHAD 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5554NP_001286784.1 PDI_a_TMX 36..136 CDD:239292 44/99 (44%)
TMX4NP_066979.2 PDI_a_TMX 37..137 CDD:239292 47/105 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..349 39/125 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I7107
eggNOG 1 0.900 - - E2759_KOG0913
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1481386at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41981
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3134
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.