DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5554 and Tmx4

DIOPT Version :9

Sequence 1:NP_001286784.1 Gene:CG5554 / 37775 FlyBaseID:FBgn0034914 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_083424.1 Gene:Tmx4 / 52837 MGIID:106558 Length:335 Species:Mus musculus


Alignment Length:344 Identity:130/344 - (37%)
Similarity:188/344 - (54%) Gaps:42/344 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CAALLLLAATAQSTAAAQSGLQPG------GKLIELDEDNWHLMLQGEWMIEFFAPWCPACKNLA 70
            |..:||.|..|   |||..||:..      .::..:...||.|:::||||::|:|||||:|:...
Mouse     6 CVPVLLAAWLA---AAAAEGLEQAALPAEESRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTD 67

  Fly    71 PTWERFARVAKDVQVQVAKIDVTTSPSLSGRFFVTALPTIYHVKDGEFRQYRGARDGDALLYFVK 135
            ..||.||:..:.:|:.|.|:||...|.||||||||.||..:|.|||.||:|||....:.|..::.
Mouse    68 SEWETFAKNGETLQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIFRRYRGPGIYEDLQNYIL 132

  Fly   136 KQQWQSIEPLSAWKKPDTTHMSVLSYFFKLSHTLKHTQKLFKDFNGRLQEEYGLPTWGSYALFAI 200
            :::|||:|||:.||.|.:..||.::..|.:|..:.|....|       ....|:|.|.||..|.|
Mouse   133 EKKWQSVEPLTGWKSPASLTMSGMAGLFSISGKIWHLHNYF-------TVTLGIPAWCSYVFFVI 190

  Fly   201 ATIFVGAALGLLLVCLVD-FVYP-PKKS-----QRQSFSESQDNLTEGLEDLATEEIEDDGDAEE 258
            ||:..|..:||:||.:.: |..| |:.|     |.||..|:|.  .|.|:|  .||.:||.:.||
Mouse   191 ATLVFGLFMGLILVVISECFCVPLPRASSERCEQEQSTGEAQG--AEQLQD--AEEEKDDSNEEE 251

  Fly   259 NDDEQRDSDEEEQE--DDDEEEEDSEEQ--VGDLATKEKEADSEPE---KEEKPEPKQAGDAAPE 316
            |.|...|.:||:::  |:||.|||.||.  .|.:|  |:.:|:...   ||....||:.| |.|.
Mouse   252 NKDSLVDDEEEKEDIGDEDEGEEDEEEDNLAGIMA--EERSDTNERAVVKEGSVSPKEDG-AHPA 313

  Fly   317 KTEQV-----RKRKPRKGD 330
            .|:.|     |:||.:..:
Mouse   314 DTQDVVEDALRQRKSQNAN 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5554NP_001286784.1 PDI_a_TMX 36..136 CDD:239292 44/99 (44%)
Tmx4NP_083424.1 Thioredoxin_like 33..133 CDD:294274 44/99 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..316 38/100 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I7013
eggNOG 1 0.900 - - E2759_KOG0913
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 207 1.000 Inparanoid score I3700
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44030
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46107
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3134
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.950

Return to query results.
Submit another query.