DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5554 and txndc5

DIOPT Version :10

Sequence 1:NP_001286784.1 Gene:CG5554 / 37775 FlyBaseID:FBgn0034914 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_989186.1 Gene:txndc5 / 394794 XenbaseID:XB-GENE-490945 Length:405 Species:Xenopus tropicalis


Alignment Length:121 Identity:44/121 - (36%)
Similarity:63/121 - (52%) Gaps:5/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LIELDEDNW--HLMLQGEWMIEFFAPWCPACKNLAPTWERFARVAKDV-QVQVAKIDVTTSPSLS 99
            |.||...|:  |: .:|...|:||||||..||.|||.||:.|...:|. .:::||:|.|....|.
 Frog   164 LYELTAANFKEHI-AEGNHFIKFFAPWCGHCKALAPAWEQLAATFQDSNSIKIAKVDCTQHNGLC 227

  Fly   100 GRFFVTALPTIYHVKDGE-FRQYRGARDGDALLYFVKKQQWQSIEPLSAWKKPDTT 154
            ....|...||:...::|| ..||:|.||.|:|..:.:.|...:.|.....:|.|.|
 Frog   228 SDNQVRGYPTLLWFRNGEKVDQYKGKRDLDSLKEYAESQLKPAEEKKEEEQKEDAT 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5554NP_001286784.1 PDI_a_TMX 36..136 CDD:239292 39/101 (39%)
txndc5NP_989186.1 PDI_a_ERp46 36..134 CDD:239303
PDI_a_ERp46 163..262 CDD:239303 39/98 (40%)
PDI_a_ERp46 296..397 CDD:239303
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.