DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5554 and CG11588

DIOPT Version :9

Sequence 1:NP_001286784.1 Gene:CG5554 / 37775 FlyBaseID:FBgn0034914 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001261729.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster


Alignment Length:136 Identity:38/136 - (27%)
Similarity:68/136 - (50%) Gaps:1/136 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GKLIELDEDNWHLMLQGEWMIEFFAPWCPACKNLAPTWERFARVAKD-VQVQVAKIDVTTSPSLS 99
            |.:..:||.||..:|.|||::...:...|:|.:......:.|..:.. :.|.:|..|::|:..|.
  Fly    49 GLITRIDEGNWKEVLTGEWLLLICSSHQPSCGDWKAVLYQLASTSMGCLDVDLAFGDLSTNFWLR 113

  Fly   100 GRFFVTALPTIYHVKDGEFRQYRGARDGDALLYFVKKQQWQSIEPLSAWKKPDTTHMSVLSYFFK 164
            |||.......:|||.|||||:...:.|.:::|..:..::|..:.|:..|..|.:|..:...:..|
  Fly   114 GRFSAFREANVYHVVDGEFRRLSSSHDTNSILNLLLLREWSELPPMPFWLHPTSTWSTSAEFVLK 178

  Fly   165 LSHTLK 170
            .:..||
  Fly   179 TAVDLK 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5554NP_001286784.1 PDI_a_TMX 36..136 CDD:239292 30/100 (30%)
CG11588NP_001261729.1 Thioredoxin_like 51..148 CDD:294274 29/96 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0913
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2346
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46107
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.