DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5554 and CG11588

DIOPT Version :10

Sequence 1:NP_001286784.1 Gene:CG5554 / 37775 FlyBaseID:FBgn0034914 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_648522.1 Gene:CG11588 / 39347 FlyBaseID:FBgn0036221 Length:270 Species:Drosophila melanogaster


Alignment Length:99 Identity:22/99 - (22%)
Similarity:40/99 - (40%) Gaps:10/99 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   594 FLQTQMGHQANRTLKEKVPINLSK--QEVDMYVKRFETIDKEKKGYVSITDIKRAMKS------F 650
            ::|:......|.....|.|:..|.  :|.:..:......|.|:...: |::.|...||      |
  Fly    17 YMQSSPHPSQNTPDTPKPPLERSPNIEEGNRIIYENHRNDMEESSRI-ISNQKIFPKSLKNKEYF 80

  Fly   651 GDAEVSGEELHDILKEIDTNMNGQVELEEYLQMM 684
            ..||.....|.||.|..: |:.|:...:.|::.:
  Fly    81 LKAERFWNRLKDIFKSSE-NIAGEAIYQVYMKRL 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5554NP_001286784.1 PDI_a_TMX 36..136 CDD:239292
CG11588NP_648522.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 51..148 CDD:469754 16/65 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.