DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5554 and C14B9.2

DIOPT Version :10

Sequence 1:NP_001286784.1 Gene:CG5554 / 37775 FlyBaseID:FBgn0034914 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_498775.2 Gene:C14B9.2 / 176147 WormBaseID:WBGene00015752 Length:618 Species:Caenorhabditis elegans


Alignment Length:165 Identity:42/165 - (25%)
Similarity:79/165 - (47%) Gaps:17/165 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PGGKLIELDEDNWHLMLQGE--WMIEFFAPWCPACKNLAPTWERFAR--VAKDVQVQVAKIDVTT 94
            |..:::.|..:|:...:...  .::||:||||..||.|||.:|:.|:  .|:..:|::.|:|.|.
 Worm   145 PPEEVVTLTTENFDDFISNNELVLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDATI 209

  Fly    95 SPSLSGRFFVTALPTIYHVKDGEFRQYRGARDGDALLYFVKKQQWQSIEPLSAWK-------KPD 152
            ...|..::.|:..||:..:::|....|.|.|:...::.::..|...:.:.|...|       |.|
 Worm   210 EKDLGTKYGVSGYPTMKIIRNGRRFDYNGPREAAGIIKYMTDQSKPAAKKLPKLKDVERFMSKDD 274

  Fly   153 TTHMSVLSYFFKLSHTLKHTQKLFKDFNGRLQEEY 187
            .|   ::.:|.....|   ..:.|.|....|:||:
 Worm   275 VT---IIGFFATEDST---AFEAFSDSAEMLREEF 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5554NP_001286784.1 PDI_a_TMX 36..136 CDD:239292 28/103 (27%)
C14B9.2NP_498775.2 pdi_dom 41..138 CDD:273454
ER_PDI_fam 147..616 CDD:273457 41/163 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.