DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and SNAP29

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_004773.1 Gene:SNAP29 / 9342 HGNCID:11133 Length:258 Species:Homo sapiens


Alignment Length:257 Identity:82/257 - (31%)
Similarity:133/257 - (51%) Gaps:21/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RSTNPFEMDDDDE----------EEITSSPSVAAQRLAYAEK---RRAIEQRTLDSTNKSLGLLY 93
            :|.|||:.|.:||          .::...|...|.|..|..:   |||  :.|..||::||.|:|
Human     6 KSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRA--EATAASTSRSLALMY 68

  Fly    94 ETQEVGKATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGLKSVFGGLKNYLSGNR-DQPPT 157
            |:::||.|::.|||:||..||:|...:|::...|:.||:|:..:|||||||.||..... :.||.
Human    69 ESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPE 133

  Fly   158 ATGSPTGSQSS--QEANSNINQGACGGASPSAPLSPAERYDNHPVSQLRGDPSST-YQPQRQAAN 219
            ..|:.|...::  :||.|...:......:....|...:  |..||.:..|...|| ..|:.....
Human   134 QNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLD--DTDPVPRGAGSAMSTDAYPKNPHLR 196

  Fly   220 PFQAQIDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDNMNYKIEDVDLKIHKQNKDMSKL 281
            .:..:|||||:|:...|..||.:|..:..|||.|:::||.:..|::.:|:.|....:.:.:|
Human   197 AYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 27/66 (41%)
SNARE_SNAP29C 222..280 CDD:277209 19/57 (33%)
SNAP29NP_004773.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 9/34 (26%)
SNARE_SNAP29N 47..111 CDD:277240 27/65 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..191 8/42 (19%)
SNARE_SNAP29C 199..257 CDD:277209 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156690
Domainoid 1 1.000 120 1.000 Domainoid score I5746
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3512
Inparanoid 1 1.050 121 1.000 Inparanoid score I4761
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48584
OrthoDB 1 1.010 - - D1358184at2759
OrthoFinder 1 1.000 - - FOG0007247
OrthoInspector 1 1.000 - - oto90064
orthoMCL 1 0.900 - - OOG6_106569
Panther 1 1.100 - - LDO PTHR19305
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2804
SonicParanoid 1 1.000 - - X6123
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.