DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and SNAP23

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_016878181.1 Gene:SNAP23 / 8773 HGNCID:11131 Length:224 Species:Homo sapiens


Alignment Length:241 Identity:59/241 - (24%)
Similarity:94/241 - (39%) Gaps:62/241 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MDDDDEEEITSSPSVAAQRLAYAEKRRAIEQRTLDSTNKSLGLLYETQEVGKATAVELAKQREQL 113
            ||:...|||             .::...|...:|:||.:.|||..|:|:.|..|...|.:|:|||
Human     1 MDNLSSEEI-------------QQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQL 52

  Fly   114 EKTSHQLDEISSTLRFSQRHLTGLKSVFG------------------GLKNYLSGNRDQPPTATG 160
            .:....||:|:..:|.:::.||.|....|                  ..||:.||...:.....|
Human    53 NRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPCNRFSDVGCFYETRTKNFESGKAYKTTWGDG 117

  Fly   161 ---SPTGSQSSQE---ANSNINQGACGGASPSAPLSPAERYDNHPVSQLRGDPSSTYQPQRQAAN 219
               ||....|.|.   .|..:.|...|.||..        |.....:..|.|             
Human   118 GENSPCNVVSKQPGPVTNGQLQQPTTGAASGG--------YIKRITNDARED------------- 161

  Fly   220 PFQAQIDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDNMNYKIE 265
                :::.||.::.|.|..||.:|.::|.||::||..:..:..|::
Human   162 ----EMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKVK 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 21/63 (33%)
SNARE_SNAP29C 222..280 CDD:277209 13/44 (30%)
SNAP23XP_016878181.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1358184at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.