DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and SPO20

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_013730.1 Gene:SPO20 / 855031 SGDID:S000004619 Length:397 Species:Saccharomyces cerevisiae


Alignment Length:349 Identity:68/349 - (19%)
Similarity:123/349 - (35%) Gaps:95/349 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 HNYLQPVHDHFDDVDRFEDVD-----------------DDLFLQNKRTGAAKLPQQ--------- 41
            |..|.| :..|||..:..|..                 :::|.::.|   .::|::         
Yeast    75 HKQLHP-NCRFDDATKTSDDKCVSYEVPERDGLATISLEEVFPKSNR---CQIPEENLGETDSVI 135

  Fly    42 -RSTNPFEMDDD------------------DEEEITSSPSVAAQRLAYAEKRRAIEQRTLDSTNK 87
             |....|..::|                  :|:||       ..||  ..:.|:.:.:::.:|::
Yeast   136 HRDLGNFANENDYPQWRKVESQYNLENVQPEEDEI-------VDRL--RSEIRSTKLKSVKTTSR 191

  Fly    88 SLGLLYETQEVGKATAVELAKQREQLEKTSHQLD--EISST--------LRFSQRHLTGLKSVFG 142
            :|....|.:..||....:|:.|..||.|.....|  :|.|.        |....|.|..|||...
Yeast   192 TLEKAIEARCTGKRVLQQLSCQSNQLTKIESNCDMLKIQSNVADRKIDELAHENRSLLALKSPNP 256

  Fly   143 GLKNYLSGNRDQPPTATGSPTGSQS-----SQEANSNI------NQGACG-GASPSAPLSPAERY 195
            ..|......|||...........|.     :|:::.|:      ..|..| |......|..|::|
Yeast   257 FRKKREREKRDQIYNLKLKHRHLQQETMKRAQDSDKNLAINLSSEYGRYGQGVERQRILRDAQKY 321

  Fly   196 DNHPVSQLRGDPSSTYQPQRQAANPFQAQIDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDNM 260
                  |...|         :..|..:..:..|||::.:....||::|...|.|.|:||..:.::
Yeast   322 ------QFEAD---------EEDNQMEIDLYGNLEQIKAVSGDLKIMAHAFGREFEAQNTRMFDI 371

  Fly   261 NYKIEDVDLKIHKQNKDMSKLLKK 284
            ...::..|..:..:...:.|::.|
Yeast   372 ENNVQQADNALQAKRYRLEKVIGK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 17/73 (23%)
SNARE_SNAP29C 222..280 CDD:277209 12/57 (21%)
SPO20NP_013730.1 SNARE_SEC9N 176..245 CDD:277239 15/68 (22%)
t_SNARE 327..392 CDD:197699 13/64 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19305
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.