DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and SEC9

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_011523.3 Gene:SEC9 / 852892 SGDID:S000003241 Length:651 Species:Saccharomyces cerevisiae


Alignment Length:279 Identity:58/279 - (20%)
Similarity:101/279 - (36%) Gaps:85/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QRSTNPFEMDDDDEEEITSSPSVAAQRLAYAEKRRAIE----------QRTLDSTNKSLGLLYET 95
            ||....||....:||        |.|:   .|:..|::          |.::.||..:|.:..:.
Yeast   401 QRGYKTFEEIQKEEE--------ARQQ---QEEDEAVDEIKQEIKFTKQSSVASTRNTLKMAQDA 454

  Fly    96 QEVGKATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGLKSVFGGLKNYLSGNRDQPPTATG 160
            :..|..|...|..|.|||......||.:....:.:...:..||.:          ||........
Yeast   455 ERAGMNTLGMLGHQSEQLNNVEGNLDLMKVQNKVADEKVAELKKL----------NRSILAVHVS 509

  Fly   161 SPTGS-----------------------QSSQE-------------ANSNINQGACGGASPSAPL 189
            :|..|                       |:||:             ||:||::            
Yeast   510 NPFNSKRRRREREEQLKNRKIEEKLMREQTSQQLSQSTQRIEGAMNANNNISE------------ 562

  Fly   190 SPAERYDNHPVSQLRGDPSSTYQPQR-QAANPFQAQIDSNLEEMCSNLSVLKMLATDLGGEIESQ 253
             ..|||....|.    :.:..||.:. :..:..:.:||.||:::....:.||.:|...|.|::||
Yeast   563 -VRERYQRKNVL----EKAKRYQFENDEEDDEMELEIDRNLDQIQQVSNRLKKMALTTGKELDSQ 622

  Fly   254 NELLDNMNYKIEDVDLKIH 272
            .:.|:|:....:|:|:.:|
Yeast   623 QKRLNNIEESTDDLDINLH 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 15/73 (21%)
SNARE_SNAP29C 222..280 CDD:277209 16/51 (31%)
SEC9NP_011523.3 SNARE_SEC9N 431..500 CDD:277239 15/78 (19%)
SNARE_SEC9C 596..649 CDD:277210 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345497
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19305
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2804
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.