DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and SNAP29

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001318503.1 Gene:SNAP29 / 830681 AraportID:AT5G07880 Length:251 Species:Arabidopsis thaliana


Alignment Length:257 Identity:64/257 - (24%)
Similarity:108/257 - (42%) Gaps:42/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 STNPFEMDDDD---EEEITSS--PSVAAQRLAYAEKRRAIEQRTLDSTNKSLGLLYETQEV---G 99
            |.|||:.||||   |:..|||  ||...:.....|........:.::|....|.|...:|:   .
plant    22 SLNPFDDDDDDKEVEKRFTSSLKPSGGKENQTVQELESYAVYNSEETTKTVQGCLKVAEEIRCDA 86

  Fly   100 KATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGLKSVFGGLKNYLSGNRDQPPTATGSPTG 164
            ..|.|.|.:|.:|:.:|..:..::...|...::.|..|..||         :|...|..:.|.||
plant    87 SKTLVMLNEQGDQITRTHQKTVDLDHHLSRGEKILGRLGGVF---------SRTWKPKKSRSITG 142

  Fly   165 SQSSQEANSNINQGACGGASPS---APLSPAERYDNHPVSQLRGDPSSTYQPQRQAANPFQ---- 222
            ...::            |.||.   ..|...|:...:|..:    |.|...|  :|.:.:|    
plant   143 PVITK------------GDSPKRKVIDLKTREKLGLNPSLK----PKSKTLP--EAVDAYQKTQI 189

  Fly   223 AQIDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDNMNYKIEDVDLKIHKQNKDMSKLLKK 284
            |:.|..|.::.:.|..||.:|.|:|..||.|...||::....::::.::.:.|:....||:|
plant   190 AKQDEALTDLSALLGELKNMAVDMGTAIERQTNELDHLQDNADELNYRVKQSNQRARYLLRK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 13/66 (20%)
SNARE_SNAP29C 222..280 CDD:277209 16/61 (26%)
SNAP29NP_001318503.1 SNARE_SNAP25N_23N_29N_SEC9N 60..122 CDD:277214 11/61 (18%)
SNARE 193..246 CDD:304603 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3897
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19305
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.