DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and Snap29

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_075837.3 Gene:Snap29 / 67474 MGIID:1914724 Length:260 Species:Mus musculus


Alignment Length:259 Identity:81/259 - (31%)
Similarity:124/259 - (47%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RSTNPFEMDDDDEEEIT------------SSPSVAAQRLAYAEK---RRAIEQRTLDSTNKSLGL 91
            :|.|||  |||.|||.|            ..|.....|..|..:   |||  :.|..||::||.|
Mouse     6 KSYNPF--DDDVEEEDTRPAPWKDVRDLPDGPDAPIDRQQYLRQEVLRRA--EATAASTSRSLSL 66

  Fly    92 LYETQEVGKATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGLKSVFGGLKNYLSGNRDQPP 156
            :||::::|.|::.||.:||..||.|...:|::...|:.||:|:..:||||||..||......:||
Mouse    67 MYESEKIGVASSEELVRQRGVLEHTEKMVDKMDQDLKMSQKHINSIKSVFGGFINYFKSKPVEPP 131

  Fly   157 TATGSPTGSQSSQEANSNINQGACGGASPSAPLSPAERYDNHPVSQLRGDPSSTYQ----PQRQA 217
            ........||.:......||..........|......|..:..:..:..:||||..    |:...
Mouse   132 PEQNGSIVSQPNSRLKEAINTSKDQENKYQASHPNLRRLQDAELDSVPKEPSSTVNTEVYPKNST 196

  Fly   218 ANPFQAQIDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDNMNYKIEDVDLKIHKQNKDMSKL 281
            ...:..:|||||:|:...|..||.:|..:..|||.|:::||.:..|::.:|:.|....|.:.:|
Mouse   197 LRTYHQKIDSNLDELSVGLGHLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKKVRQL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 25/66 (38%)
SNARE_SNAP29C 222..280 CDD:277209 20/57 (35%)
Snap29NP_075837.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 17/50 (34%)
SNARE_SNAP29N 47..111 CDD:277240 27/63 (43%)
SNARE_SNAP29C 201..259 CDD:277209 14/45 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847098
Domainoid 1 1.000 119 1.000 Domainoid score I5767
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3512
Inparanoid 1 1.050 120 1.000 Inparanoid score I4769
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48584
OrthoDB 1 1.010 - - D1358184at2759
OrthoFinder 1 1.000 - - FOG0007247
OrthoInspector 1 1.000 - - oto93640
orthoMCL 1 0.900 - - OOG6_106569
Panther 1 1.100 - - LDO PTHR19305
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2804
SonicParanoid 1 1.000 - - X6123
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.