DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and SNAP25

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001309831.1 Gene:SNAP25 / 6616 HGNCID:11132 Length:206 Species:Homo sapiens


Alignment Length:229 Identity:48/229 - (20%)
Similarity:95/229 - (41%) Gaps:59/229 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 KRRA--IEQRTLDSTNKSLGLLYETQEVGKATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLT 135
            :|||  :...:|:||.:.|.|:.|:::.|..|.|.|.:|.|||::....::.|:..::.::::|.
Human    15 QRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLK 79

  Fly   136 GLKSVFGGLKNYLSGNRDQPPTATGSPTGSQSSQEANSNINQGACGG--ASPSAPLSPAERY--- 195
            .|                                        |.|.|  ..|...|..::.|   
Human    80 DL----------------------------------------GKCCGLFICPCNKLKSSDAYKKA 104

  Fly   196 -DNHPVSQLRGDPSSTYQPQRQAA-----------NPFQAQIDSNLEEMCSNLSVLKMLATDLGG 248
             .|:....:...|:.....:.|.|           :..:.::|.|||::...:..|:.:|.|:|.
Human   105 WGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGN 169

  Fly   249 EIESQNELLDNMNYKIEDVDLKIHKQNKDMSKLL 282
            ||::||..:|.:..|.:....:|.:.|:..:|:|
Human   170 EIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 19/64 (30%)
SNARE_SNAP29C 222..280 CDD:277209 16/57 (28%)
SNAP25NP_001309831.1 SNARE_SNAP25N 10..82 CDD:277247 20/106 (19%)
SNAP-25 91..141 CDD:395673 7/49 (14%)
SNARE_SNAP25C 143..201 CDD:277238 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.