DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and snap29

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_988988.1 Gene:snap29 / 394585 XenbaseID:XB-GENE-941286 Length:257 Species:Xenopus tropicalis


Alignment Length:261 Identity:78/261 - (29%)
Similarity:134/261 - (51%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RSTNPFEMDDDDE---------EEITSSPSVAAQRLAYAEKRRAIEQRT-------LDSTNKSLG 90
            ||.|||:.|:||:         .:....|....:|.| |:|:|:::|..       :||:|:||.
 Frog     3 RSYNPFDEDEDDDFKPVKWNDAADPYEDPVEKRKREA-ADKQRSLQQEVTRRAESMVDSSNRSLS 66

  Fly    91 LLYETQEVGKATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGLKSVFGGLKNYLSGNRDQP 155
            |:|:::::|..||.||.:|.|.|::|...:|::...::.||:|:..:||:|.|..||.   |.:|
 Frog    67 LVYDSEKIGVDTAEELVRQGEALKRTERMVDKMEQDMKTSQKHINSIKSMFSGFTNYF---RSKP 128

  Fly   156 PTATGSPTGSQSSQEANSNINQGACGGASPSAPLSPAERYD-NHP---------VSQLRGDPSST 210
              |...|....|..::::.:.:..      |:..:..::|. .||         .|...|..||.
 Frog   129 --AETPPENGASEYKSSTKLEEAL------SSSKAQEDKYQATHPNLLKRETLESSNNMGASSSG 185

  Fly   211 YQPQRQAANPFQAQIDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDNMNYKIEDVDLKIHKQN 275
            ||.:.|....:..::||||::|...|..||.||..|..||:.|:|:|..:..|::.:||.|...:
 Frog   186 YQHKNQVLRNYHQKVDSNLDDMSLGLGRLKNLALGLQTEIDDQDEMLGRLTGKVDKMDLNIKTTD 250

  Fly   276 K 276
            |
 Frog   251 K 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 23/70 (33%)
SNARE_SNAP29C 222..280 CDD:277209 21/55 (38%)
snap29NP_988988.1 SNARE_SNAP29N 48..112 CDD:277240 21/63 (33%)
SNARE_SNAP29C 197..254 CDD:277209 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5944
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3512
Inparanoid 1 1.050 116 1.000 Inparanoid score I4669
OMA 1 1.010 - - QHG48584
OrthoDB 1 1.010 - - D1358184at2759
OrthoFinder 1 1.000 - - FOG0007247
OrthoInspector 1 1.000 - - oto103872
Panther 1 1.100 - - LDO PTHR19305
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2804
SonicParanoid 1 1.000 - - X6123
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.