DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and snap23.1

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_005158781.1 Gene:snap23.1 / 393159 ZFINID:ZDB-GENE-040426-883 Length:237 Species:Danio rerio


Alignment Length:272 Identity:64/272 - (23%)
Similarity:108/272 - (39%) Gaps:61/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 AKLPQ---------QRSTNPFEMDDDDEEEITSSPSVAAQRLAYAEKRRAIEQRTLDSTNKSLGL 91
            :|.||         :.:.:..:|.|...|:||.             :...:...:|:||.:.|.:
Zfish     2 SKQPQSVELKVTGGEANLDTSKMADMTVEDITM-------------RANQVTDESLESTRRMLQM 53

  Fly    92 LYETQEVGKATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGLKSVFG-------------- 142
            ..|::|.|..|...|.:|.|||.:....:|:|:..:|.::::||.|....|              
Zfish    54 AEESRETGVKTMTMLDEQGEQLRRVDQGMDQINQDMRQAEKNLTDLSKCCGLCVCPCERVTSIEH 118

  Fly   143 -GLKNYLSGNRDQPPTATGSPTGSQSSQEANSNINQGACGGAS-PSAPLSPAERYDNHPVSQLRG 205
             |......|......:..|...|..|||.......|...||:| .|.|      |.....:..|.
Zfish   119 DGRYKRTWGTGSDNSSTEGKEGGVVSSQPTAVRNGQAVSGGSSGASGP------YIKRITNDARE 177

  Fly   206 DPSSTYQPQRQAANPFQAQIDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDNMNYKIEDVDLK 270
            |                 :::.||:::.|.:..||.||.|:|.||:.||:.:|.:..|.:....:
Zfish   178 D-----------------EMEENLDQVGSIIGNLKNLALDMGNEIDKQNKTIDRITDKADMNKAR 225

  Fly   271 IHKQNKDMSKLL 282
            |.:.|:..:|||
Zfish   226 IDEANQRANKLL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 17/63 (27%)
SNARE_SNAP29C 222..280 CDD:277209 17/57 (30%)
snap23.1XP_005158781.1 SNARE_SNAP25N_23N 34..98 CDD:277242 17/76 (22%)
SNAP-25 109..175 CDD:279208 14/71 (20%)
SNARE_SNAP23C 177..235 CDD:277237 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1358184at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.