DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and Snap25

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001036641.1 Gene:Snap25 / 3355084 FlyBaseID:FBgn0011288 Length:212 Species:Drosophila melanogaster


Alignment Length:253 Identity:66/253 - (26%)
Similarity:108/253 - (42%) Gaps:59/253 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MDDDDEEEITSSPSVAAQRLAYAE-KRRAIEQRTLDSTNKSLGLLYETQEVGKATAVELAKQREQ 112
            |..|..||:  :|.|....|...: ..:.:...:|:||.:.|.|..|::|.|..|.|.|..|.||
  Fly     1 MPADPSEEV--APQVPKTELEELQINAQGVADESLESTRRMLALCEESKEAGIRTLVALDDQGEQ 63

  Fly   113 LEKTSHQLDEISSTLRFSQRHLTGLKSVFGGLKNYLSGNRDQPPTATGSPTGSQSSQEANSNINQ 177
            |::....:|:|::.:|.::::|:|::...|..  .|..|:            |||.:|     :.
  Fly    64 LDRIEEGMDQINADMREAEKNLSGMEKCCGIC--VLPCNK------------SQSFKE-----DD 109

  Fly   178 GACGGASPSAPLSPAERYDNHPVSQLRGDPSSTYQPQR--QAANPFQAQI--------DSNLEEM 232
            |...|..           |...|:.         ||||  ...|...||.        |:..:||
  Fly   110 GTWKGND-----------DGKVVNN---------QPQRVMDDRNGMMAQAGYIGRITNDAREDEM 154

  Fly   233 CSNLSV-------LKMLATDLGGEIESQNELLDNMNYKIEDVDLKIHKQNKDMSKLLK 283
            ..|:..       |:.:|.|:|.|:|:||..:|.:|.|.|..:.:|...|:...:|||
  Fly   155 EENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKGESNEARIAVANQRAHQLLK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 19/64 (30%)
SNARE_SNAP29C 222..280 CDD:277209 20/72 (28%)
Snap25NP_001036641.1 SNARE_SNAP25N_23N 28..87 CDD:277242 19/58 (33%)
SNAP-25 98..149 CDD:279208 16/87 (18%)
SNARE_SNAP25C 151..209 CDD:277238 17/57 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464339
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.