DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and snap25b

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_571509.1 Gene:snap25b / 30711 ZFINID:ZDB-GENE-980526-392 Length:203 Species:Danio rerio


Alignment Length:243 Identity:57/243 - (23%)
Similarity:102/243 - (41%) Gaps:55/243 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DDDDEEEITSSPSVAAQRLAYAEKRRAIEQRTLDSTNKSLGLLYETQEVGKATAVELAKQREQLE 114
            |:.|.....:.....|.:|.         ..:|:||.:.|.|:.|:::.|..|.|.|.:|.||||
Zfish     3 DESDMRNELNDMQARADQLG---------DESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLE 58

  Fly   115 KTSHQLDEISSTLRFSQRHLTGLKSVFGGLK---NYLSG-------NRDQPPTATGSPTGSQSSQ 169
            :....:|:|:..::.::::||.|.::.|...   |.|.|       |:|          |..|||
Zfish    59 RIEEGMDQINKDMKEAEKNLTDLGNLCGLCPCPCNKLKGGGQSWGNNQD----------GVVSSQ 113

  Fly   170 EANSNINQGACGGASPSAPLSPAERYDNHPVSQLRGDPSSTYQPQRQAANPFQAQIDSNLEEMCS 234
                                 ||...|......:.|.     ..:|...:..:.::|.|||::.|
Zfish   114 ---------------------PARVVDEREQMAISGG-----FIRRVTNDARENEMDENLEQVGS 152

  Fly   235 NLSVLKMLATDLGGEIESQNELLDNMNYKIEDVDLKIHKQNKDMSKLL 282
            .:..| .:|.|:|.||::||..:|.:....:....:|.:.|:..:|:|
Zfish   153 IIGNLXHMALDMGNEIDTQNRQIDRIMDMADSNKTRIDEANQRATKML 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 18/63 (29%)
SNARE_SNAP29C 222..280 CDD:277209 16/57 (28%)
snap25bNP_571509.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 4/30 (13%)
SNARE_SNAP25N 10..82 CDD:277247 21/80 (26%)
SNAP-25 91..138 CDD:279208 14/82 (17%)
SNARE_SNAP25C 140..198 CDD:277238 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.