DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and Snap23

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001171263.1 Gene:Snap23 / 20619 MGIID:109356 Length:221 Species:Mus musculus


Alignment Length:253 Identity:62/253 - (24%)
Similarity:100/253 - (39%) Gaps:53/253 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MDDDDEEEITSSPSVAAQRLAYAEKRRAIEQRTLDSTNKSLGLLYETQEVGKATAVELAKQREQL 113
            ||:...||:..             :...:...:|:||.:.|||..|:|:.|..|...|.:|.|||
Mouse     1 MDNLSPEEVQL-------------RAHQVTDESLESTRRILGLAIESQDAGIKTITMLDEQGEQL 52

  Fly   114 EKTSHQLDEISSTLRFSQRHLTGLKSVFG------------------GLKNYLSGNRDQPPTATG 160
            .:....:|:|:..:|.:::.||.|....|                  ..||:.||.         
Mouse    53 NRIEEGMDQINKDMREAEKTLTELNKCCGLCICPCNRFSVGDCFFETRTKNFESGK--------- 108

  Fly   161 SPTGSQSSQEANSNINQGACGGASPSAPLS-PAERYDNHPVSQLRGDPSSTYQPQRQAANPFQAQ 224
                       |.....|..|..|||..:| ...|..|....|..|..|..| .:|...:..:.:
Mouse   109 -----------NYKATWGDGGDNSPSNVVSKQPSRITNGQPQQTTGAASGGY-IKRITNDAREDE 161

  Fly   225 IDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDNMNYKIEDVDLKIHKQNKDMSKLL 282
            ::.||.::.|.|..||.:|.|:|.||::||:.:..:..|.:....:|...|....||:
Mouse   162 MEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRIDIANTRAKKLI 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 19/63 (30%)
SNARE_SNAP29C 222..280 CDD:277209 16/57 (28%)
Snap23NP_001171263.1 SNARE_SNAP23N 9..75 CDD:277248 19/78 (24%)
SNAP-25 100..157 CDD:366328 18/77 (23%)
SNARE_SNAP23C 159..217 CDD:277237 16/57 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.