DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and aex-4

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_508641.2 Gene:aex-4 / 188509 WormBaseID:WBGene00006454 Length:234 Species:Caenorhabditis elegans


Alignment Length:218 Identity:40/218 - (18%)
Similarity:75/218 - (34%) Gaps:46/218 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RAIEQRTLDSTNKSLGLLYETQEVGKATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGLKS 139
            |.|:|..:|:..               |...|..|.|||:|....|..:...|.....::|.::.
 Worm    52 RDIDQMNVDAVQ---------------TTAALEDQDEQLDKIEANLSNVIDDLNVVSHNITAMEH 101

  Fly   140 VFG---------GLKNYLSGNRD-QPPTATGSPTGSQSSQEANSNINQGACGGASPSAPLSPAER 194
            ..|         ..|.:....|| .........|..:..::..||:..                 
 Worm   102 YCGCGFFRILRAPFKYFRKRERDIIKEEVLEKMTSPKLRRKEESNMMM----------------- 149

  Fly   195 YDNHPVSQLRGDPSSTYQPQRQAANPFQAQIDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDN 259
            :.|   |..|.:.:..:. :|...:..:.:::.||.::...|..:|.||.|:..:::.|...|:.
 Worm   150 FTN---SSKRRESTGDFM-KRLTCDAIEDELERNLMQIDQGLESVKNLAVDMHVQLKLQEPKLNR 210

  Fly   260 MNYKIEDVDLKIHKQNKDMSKLL 282
            :....|..|..:...|..:.|||
 Worm   211 IEELTETNDFVVEGVNDKVKKLL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 13/60 (22%)
SNARE_SNAP29C 222..280 CDD:277209 12/57 (21%)
aex-4NP_508641.2 SNARE 31..99 CDD:304603 14/61 (23%)
SNARE 173..231 CDD:304603 12/57 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.