DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and ric-4

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001123033.1 Gene:ric-4 / 179427 WormBaseID:WBGene00004364 Length:234 Species:Caenorhabditis elegans


Alignment Length:274 Identity:58/274 - (21%)
Similarity:99/274 - (36%) Gaps:105/274 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PFEMDDD--------DEEEITSSPSVAAQRLAYAEKRRAIEQRTLDSTNKSLGLLYETQEVGKAT 102
            |.:|.|:        ||:.|.|                      |:||.:.|.|..|::|.|..|
 Worm    31 PADMSDELKGLNVGIDEKTIES----------------------LESTRRMLALCEESKEAGIKT 73

  Fly   103 AVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGL------------------KSVF-------- 141
            .|.|..|.||||:....||.|:..::.::.||.|:                  |:.|        
 Worm    74 LVMLDDQGEQLERCEGALDTINQDMKEAEDHLKGMEKCCGLCVLPWNKTDDFEKTEFAKAWKKDD 138

  Fly   142 -GGLKNYLSGNRDQPPTATGSPTGSQSSQEANSNINQGACGGASPSAPLSPAERYDNHPVSQLRG 205
             ||:.:      |||....|             :.:.|..||            |.....:..|.
 Worm   139 DGGVIS------DQPRITVG-------------DSSMGPQGG------------YITKITNDARE 172

  Fly   206 DPSSTYQPQRQAANPFQAQIDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDNMNYKIEDVDLK 270
            |                 ::|.|::::.:.:..|:.:|.|:..|:.:||..||.::.|.:..:::
 Worm   173 D-----------------EMDENVQQVSTMVGNLRNMAIDMSTEVSNQNRQLDRIHDKAQSNEVR 220

  Fly   271 IHKQNKDMSKLLKK 284
            :...||....|:.|
 Worm   221 VESANKRAKNLITK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 21/63 (33%)
SNARE_SNAP29C 222..280 CDD:277209 13/57 (23%)
ric-4NP_001123033.1 SNARE_SNAP25N_23N 45..107 CDD:277242 25/83 (30%)
SNAP-25 118..170 CDD:279208 12/82 (15%)
SNARE_SNAP25C 172..230 CDD:277238 14/74 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.