DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and Snap29

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_446262.3 Gene:Snap29 / 116500 RGDID:620225 Length:257 Species:Rattus norvegicus


Alignment Length:267 Identity:83/267 - (31%)
Similarity:135/267 - (50%) Gaps:42/267 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 RSTNPFEMDDDDEE----------EITSSPSVAAQRLAYAEK---RRAIEQRTLDSTNKSLGLLY 93
            :|.|||:.|.:||:          ::...|.....|..|..:   |||  :.|..||::||.|:|
  Rat     6 KSYNPFDDDVEDEDTRPAPWKDARDLPDGPDAPIDRQQYLRQEVLRRA--EATAASTSRSLSLMY 68

  Fly    94 ETQEVGKATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGLKSVFGGLKNYLSGNR-DQPPT 157
            |::::|.|::.||.:||..||.|...:|::...|:.||:|:..:||||||..||..... :.||.
  Rat    69 ESEKIGVASSEELVRQRGVLEHTEKMVDKMDQDLKMSQKHINSIKSVFGGFINYFKSKPVEPPPE 133

  Fly   158 ATGS--PTGSQSSQEA-NSNINQGACGGASPSAPLSPAERYDNHP------VSQLRGDPSSTYQ- 212
            ..||  |..|...:|| |::.:|.:...||             ||      .::|...|:||.. 
  Rat   134 QNGSIVPQPSSRLKEAINTSKDQESKYQAS-------------HPNLRRLHDAELDSVPASTVNT 185

  Fly   213 ---PQRQAANPFQAQIDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDNMNYKIEDVDLKIHKQ 274
               |:..:...:..:|||||:|:...|..||.:|..:..|||.|:::||.:..|::.:|:.|...
  Rat   186 EVYPKNSSLRAYHQKIDSNLDELSVGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKST 250

  Fly   275 NKDMSKL 281
            .|.:.:|
  Rat   251 EKKVRQL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 25/66 (38%)
SNARE_SNAP29C 222..280 CDD:277209 20/57 (35%)
Snap29NP_446262.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42 13/48 (27%)
SNARE_SNAP29N 47..111 CDD:277240 27/63 (43%)
SNARE_SNAP29C 198..256 CDD:277209 15/48 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350608
Domainoid 1 1.000 111 1.000 Domainoid score I6094
eggNOG 1 0.900 - - E1_KOG3065
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3512
Inparanoid 1 1.050 112 1.000 Inparanoid score I4769
OMA 1 1.010 - - QHG48584
OrthoDB 1 1.010 - - D1358184at2759
OrthoFinder 1 1.000 - - FOG0007247
OrthoInspector 1 1.000 - - oto97182
orthoMCL 1 0.900 - - OOG6_106569
Panther 1 1.100 - - LDO PTHR19305
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6123
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.