DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snap29 and snap23

DIOPT Version :9

Sequence 1:NP_523831.1 Gene:Snap29 / 37774 FlyBaseID:FBgn0034913 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001107340.1 Gene:snap23 / 100135161 XenbaseID:XB-GENE-942565 Length:205 Species:Xenopus tropicalis


Alignment Length:247 Identity:64/247 - (25%)
Similarity:104/247 - (42%) Gaps:54/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 MDDDDEEEITSSPSVAAQRLAYAEKRRAIEQRTLDSTNKSLGLLYETQEVGKATAVELAKQREQL 113
            |||...|||..             |...:...:|:||.:.|.|..|:|:.|..|...|.:|.|||
 Frog     1 MDDMTPEEIQL-------------KANQVTDDSLESTRRMLNLALESQDTGIKTITMLDEQGEQL 52

  Fly   114 EKTSHQLDEISSTLRFSQRHLTGLKSVFG-------GLKNYLSGNRDQPPTATGSPTGSQSSQEA 171
            .:....:|:|:..:|.::::||.|....|       ..|::.||...:      ...||:.:...
 Frog    53 NRIEEGMDQINKDMREAEKNLTELNKCCGLCVCPGKRPKDFESGENYK------KTWGSKDNDSE 111

  Fly   172 NSNINQ-----GACGGASPSAPLSPAERYDNHPVSQLRGDPSSTYQPQRQAANPFQAQIDSNLEE 231
            |....|     |..||.:.|.|.          :.::.||..             :.::|.||.:
 Frog   112 NVISKQPHQTNGQQGGVAQSGPY----------IKRITGDDR-------------EDEMDENLTQ 153

  Fly   232 MCSNLSVLKMLATDLGGEIESQNELLDNMNYKIEDVDLKIHKQNKDMSKLLK 283
            :.|.|..||.:|.|:|.|:||.|:.:|.:|.|.|....:|.:.|....||::
 Frog   154 VGSILGNLKNMAIDMGNELESHNQQIDRINEKAETNKTRIDEANTRAKKLIE 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snap29NP_523831.1 SNARE_SNAP29N 72..136 CDD:277240 19/63 (30%)
SNARE_SNAP29C 222..280 CDD:277209 20/57 (35%)
snap23NP_001107340.1 SNARE 9..75 CDD:389950 20/78 (26%)
SNAP-25 86..141 CDD:366328 12/70 (17%)
SNARE_SNAP23C 144..202 CDD:277237 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1358184at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.