DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GlyT and si:ch211-132b12.6

DIOPT Version :9

Sequence 1:NP_611836.2 Gene:GlyT / 37772 FlyBaseID:FBgn0034911 Length:1188 Species:Drosophila melanogaster
Sequence 2:NP_001038523.1 Gene:si:ch211-132b12.6 / 564583 ZFINID:ZDB-GENE-050420-179 Length:577 Species:Danio rerio


Alignment Length:574 Identity:238/574 - (41%)
Similarity:346/574 - (60%) Gaps:35/574 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ESEHERGTWTGRFDFLLSLLGYSVGLGNVWRFPYLCYNNGGGAFLIPFTIMLVIAGLPLMFMELS 116
            |...|||.|..:.:|||::.|..||||||||||||||.||||.||||:.:.:|..||||..:|.:
Zfish     6 EEIEERGFWGKKAEFLLAVAGNVVGLGNVWRFPYLCYRNGGGVFLIPYLVFVVTCGLPLFLLETA 70

  Fly   117 FGQYAALGPVAVYRRFCPLFRGLGTGMILVSAIVMLYYNLIIAWTIFYMFASFAPVLPWQNCEPA 181
            .||:...|.:..:.|.|||.:|:|....|......:||.:|:||.:||:.:||:..|||.:|...
Zfish    71 MGQFTHEGGITCWHRLCPLAQGVGYAGQLTVLYSCMYYTIILAWALFYLVSSFSSQLPWVSCNNI 135

  Fly   182 WSTKYCFSYAQADQCEATNGTYYLRTCHNATSAAENNITTLALGALKRPPAEEYFNNFVLGLSKG 246
            |:|..|.:.|      |.|.|:...|..|:|||                 |.|::...||.||.|
Zfish   136 WNTDNCVNLA------AGNLTFNRTTLANSTSA-----------------ATEFWERRVLSLSGG 177

  Fly   247 IEETGSIKLSLAACLFLAWTIVFLCLCKGVQSSGKVVYFTALFPYVVLVILFVRGVTLPGASTGI 311
            ||:.|.|...:..||...|.|.:.|:.|||:|:||||||||.||||:|::|.:||:|||||..|:
Zfish   178 IEDIGKINWEILLCLIAMWIICYFCIWKGVKSTGKVVYFTATFPYVMLLVLLIRGLTLPGALQGV 242

  Fly   312 LFYLTPDWKQLANAQVWGDAAVQIFFALSPAWGGLITLSSYNKFSNNCYKDSLIVAFCNIATSFF 376
            :|||.|:..:||:.|||.:|..|:||:.|...|.||:|.|||::|||||:||..:...|..|||.
Zfish   243 VFYLYPEPARLADPQVWMEAGTQVFFSYSVCSGILISLGSYNQYSNNCYRDSFWLCLLNSGTSFV 307

  Fly   377 AGLVIFSIIGFLAHELNVDVEKVVDQGAGLAFIVYPEVVTRLPVSPVWAVLFFVMLLTLGLDSQF 441
            ||..:||::||:||...|.||:|.:.|.|||||.||:.:..:|...:|||.||:|::.|||||||
Zfish   308 AGFAVFSVLGFMAHVQGVPVEEVAESGPGLAFIAYPQAMAMMPFPQLWAVCFFIMIILLGLDSQF 372

  Fly   442 ALMETVTTAILDRFPN-LR---QYKIWVVLSVAIFGYIGGLGFTTNSGMYWLQLMDKYAANWSVL 502
            ..:|.|.|:::|.||. ||   :.:::|:| :.:..:.|.|...|..|||..||.|.||.|.:.|
Zfish   373 VGIECVITSVMDLFPEVLRRAGRRELFVLL-LCLTCFFGQLIMVTEGGMYVFQLFDNYACNGACL 436

  Fly   503 L-IAISECILIAWIYGSQRFLNDIQGMIGKRSWFWNFFWGIMWRYITPATLLFILFFNWVEYKPA 566
            | :::.|.:.|.|::|:::..:.|:.|...|.   |:::.:.|:|:||...|....::.|.|.|.
Zfish   437 LFLSVFESLAIGWLFGAEKMFDIIEDMTESRP---NYWFMLCWKYLTPLVSLMSFVYSMVRYTPL 498

  Fly   567 KYGH-YVYPMWADAVGWIVGLLPVLVIFLVAFQEIWRAPMSLSFRDRIKHLLQP 619
            .:.. ||||.||.|:||::.|..:|::...|..::|....:|  :.|..||..|
Zfish   499 TFNRWYVYPDWAYALGWLLALSSILLVPGWALGQMWAGKGTL--KQRWGHLCSP 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GlyTNP_611836.2 SNF 57..603 CDD:249680 231/551 (42%)
si:ch211-132b12.6NP_001038523.1 SLC6sbd-TauT-like 11..550 CDD:271387 235/567 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D250396at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.