DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4797 and GEX2

DIOPT Version :9

Sequence 1:NP_726368.2 Gene:CG4797 / 37770 FlyBaseID:FBgn0034909 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_013032.1 Gene:GEX2 / 853981 SGDID:S000001814 Length:615 Species:Saccharomyces cerevisiae


Alignment Length:428 Identity:77/428 - (17%)
Similarity:142/428 - (33%) Gaps:142/428 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VLLLSAG--CGMPIGFSAILLPQLMDNNSTEIPIDVETGSWIASVHSL---------ATPFGS-L 117
            :||:|..  ||..|.         :|...........|.|:  |.|||         ....|| :
Yeast    60 ILLISTAFVCGFGIS---------LDYTLRSTYTGYATNSY--SEHSLLSTVQVINAVVSVGSQV 113

  Fly   118 LSGPLADYLGRRRTLILSVIPLLLGWSTLAIAKSIKVVIFAR----FLCGF-ATGILGGPGQVYI 177
            :...|:|:.||.|..:::.|..::|  |:..:::.::.::|.    :.||: .|.:|   ..:.:
Yeast   114 VYSRLSDHFGRLRLFLVATIFYIMG--TIIQSQATRLTMYAAGSVFYNCGYVGTNLL---LTLIL 173

  Fly   178 AETAEPNLRSLLIGAPYVAY------SSGILMVYSLGSMMYWRSVAWCANVLPLLSMVSISFIPE 236
            ::.:....|.....|.|..|      |..|:...:......|....| |.:.| ||.:.|.|:  
Yeast   174 SDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMW-AFIYP-LSTLPIIFL-- 234

  Fly   237 TPAWLLRNGHEKRALQALSFLRGSEISAQKELNDMKQRLAKERVTTKTNENIFQLCCQRVAIKPL 301
                             :.::: .:.|...|...:|::..||| |....||:             
Yeast   235 -----------------ILYMK-YKSSKTAEWRSLKEQARKER-TGGLFENL------------- 267

  Fly   302 VIVIVFSLLQMFSGTFIVIFYAVDMISEFGAEFDSKQAAIATAVVRVICCMVFCVVLIFVRRRRI 366
                            :.:|:.:|::.                           ::||.|     
Yeast   268 ----------------VFLFWKLDIVG---------------------------ILLITV----- 284

  Fly   367 MIVSGIGSGLFCLVLSVYQYARFDQPKMSYDVFVGAGCLLGYIIFNTALMVMPGIMIGELFPARI 431
                .:|..|..|.|:.....::...|: ....|..|||....::..|......::..:|...| 
Yeast   285 ----SLGCILVPLTLANETSQKWHNSKI-IATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSDR- 343

  Fly   432 RGRTAGGVFASMNVALFIFAKKF-------PALQAMLK 462
                  |::|.:.|..|.|...|       |.|...:|
Yeast   344 ------GIWAPLGVTFFNFFTFFISCDYLYPVLLVSMK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4797NP_726368.2 MFS 64..484 CDD:119392 77/428 (18%)
Sugar_tr 89..497 CDD:278511 70/402 (17%)
GEX2NP_013032.1 MFS_ARN_like 59..571 CDD:340880 77/428 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.