DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4797 and PMT2

DIOPT Version :9

Sequence 1:NP_726368.2 Gene:CG4797 / 37770 FlyBaseID:FBgn0034909 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_179210.1 Gene:PMT2 / 816110 AraportID:AT2G16130 Length:511 Species:Arabidopsis thaliana


Alignment Length:485 Identity:113/485 - (23%)
Similarity:204/485 - (42%) Gaps:51/485 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RGMMHQILATCAVL--LLSAGCGMPIGF---SAILLPQLMDNNSTEIPIDVETGSWIASVHSLAT 112
            ||...:....||:|  :.|...|..||.   :||.:..  |...:::.:::..|  |.:::||  
plant    19 RGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKD--DLKLSDVQLEILMG--ILNIYSL-- 77

  Fly   113 PFGSLLSGPLADYLGRRRTLILSVIPLLLGWSTLAIAKSIKVVIFARFLCGFATGILGGPGQVYI 177
             .||..:|..:|::|||.|::|:......|...:..|.:...::..||:.|...|.......||.
plant    78 -IGSGAAGRTSDWIGRRYTIVLAGFFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVYT 141

  Fly   178 AETAEPNLRSLLIGAPYVAYSSGILMVY-------SLGSMMYWRSVAWCANVLPLLSMVSISFIP 235
            .|.|..:.|..|...|.:..:.|||:.|       .|...:.||.:.....|..:...:.:..:|
plant   142 TEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPEHIGWRFMLGIGAVPSVFLAIGVLAMP 206

  Fly   236 ETPAWLLRNGHEKRALQALSFLRGSEISAQKELNDMKQR------LAKERVTTKTNENIFQLCCQ 294
            |:|.||:..|....|.:.|.....::..|...|||:|:.      :..:.:.....::..:...:
plant   207 ESPRWLVMQGRLGDAFKVLDKTSNTKEEAISRLNDIKRAVGIPDDMTDDVIVVPNKKSAGKGVWK 271

  Fly   295 RVAIKP-------LVIVIVFSLLQMFSGTFIVIFYAVDMISEFGAEFDSKQ--AAIATAVVRVIC 350
            .:.::|       |:..:.....|..||...|:.|:..:.|..|.:..:.|  |.:|..||:.:.
plant   272 DLLVRPTPSVRHILIACLGIHFSQQASGIDAVVLYSPTIFSRAGLKSKNDQLLATVAVGVVKTLF 336

  Fly   351 CMV-FCVVLIFVRRRRIMIVSGIGSGLFCLV---LSVYQYARFDQPKMSYDVFVGAGCLLGYI-I 410
            .:| .|:|..|  .||.::::.:|...|.|.   .|:....|.....:.:.:.:....::.:: .
plant   337 IVVGTCLVDRF--GRRALLLTSMGGMFFSLTALGTSLTVIDRNPGQTLKWAIGLAVTTVMTFVAT 399

  Fly   411 FNTALMVMPGIMIGELFPARIRGRTAGGVFASMNVAL-----FIFAKKFPALQAMLKMRGVFLVF 470
            |:.....:..:...|:||.|:|.:.     ||:.|.|     .|....|.:|...|.:.|.||:|
plant   400 FSLGAGPVTWVYASEIFPVRLRAQG-----ASLGVMLNRLMSGIIGMTFLSLSKGLTIGGAFLLF 459

  Fly   471 GVSSFLLTAFMCLFQPETKGRSLEHIEDYF 500
            ...:.....|...|.|||:|..||.||..|
plant   460 AGVAVAAWVFFFTFLPETRGVPLEEIESLF 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4797NP_726368.2 MFS 64..484 CDD:119392 100/456 (22%)
Sugar_tr 89..497 CDD:278511 98/439 (22%)
PMT2NP_179210.1 Sugar_tr 29..489 CDD:278511 110/473 (23%)
MFS 31..473 CDD:119392 99/455 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.