DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4797 and CG17930

DIOPT Version :9

Sequence 1:NP_726368.2 Gene:CG4797 / 37770 FlyBaseID:FBgn0034909 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_650533.1 Gene:CG17930 / 41979 FlyBaseID:FBgn0038416 Length:502 Species:Drosophila melanogaster


Alignment Length:476 Identity:98/476 - (20%)
Similarity:179/476 - (37%) Gaps:85/476 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 TCAVLL-LSAGCGMPIGFSAILLPQLMDNNSTEIPIDVETGSWIASVHSLATPFGSLLSGPLADY 125
            |.|.|| :.||..|..|....|  ..:..|:.|...     ||...|     ..|:::|...:.:
  Fly    66 TAATLLFVYAGMDMAQGLGWNL--TAVSANTLEFQY-----SWFIGV-----IIGAVVSAITSAF 118

  Fly   126 LGRRRTLILSVIPLLLGWSTLAIAKSIKVVIF------------ARFLCGFATGILGGPGQVYIA 178
            |           |.::.:....:...|..:||            ||::.|...|::..|..::.|
  Fly   119 L-----------PKIVFYGLGGVMNLIDAIIFVSAPYEYESILAARYVGGVGIGLITVPFLIHSA 172

  Fly   179 ETAEPNLRSLLIGAPYVAYSSGILMVYSLGSMMYW-RSVAWCAN--------VLPLLSMVSISFI 234
            |.|....|...........:.|:.:.....|.  | :.:....|        |...:::.|::..
  Fly   173 EIASSTNRGTCCALEQYGLALGVAIQVIYDSQ--WSQGLGMTINRVHGIFGIVFTAIALGSVAIT 235

  Fly   235 PETPAWLLRNGHEKRALQALSFLRGSEISAQKELNDMKQRLAKERVTTKTNENIFQLCCQRVAIK 299
            .::|.:.:|...|::|..::..|.||..:  :|..|.....||..|...:.:.:.:...:  ::.
  Fly   236 IDSPIFYIRQNQEQKARASVKQLMGSYWT--REAGDRAYDEAKLYVVEGSAQGVGEQLGE--SMM 296

  Fly   300 PLVIVIVFSLLQMFSGTFIV-IFYAVDMISEFGAEFDSKQAAIATAVVRVICCMVFCVVLIFVRR 363
            |.:.:::|.....|  ||.| :.|::...:|...........|...::|:|..::...||..|.|
  Fly   297 PFLKLLLFRCFVAF--TFSVPLSYSILTTTELVEGTLHSWPTIIFGLLRLIGALITFAVLDTVGR 359

  Fly   364 RRIMIVSGIGSGLFCL------VLSVY-QYAR-FDQPKMSYDVFVGAGCLLG--YIIFNTALMVM 418
            :.:.::     ||.|:      :..|| .|.. ||      |.|:...|.||  :..|....:..
  Fly   360 KFVSLL-----GLMCMAGLMLGMAGVYGDYGHIFD------DYFMWQVCRLGMAFQFFAGFFICS 413

  Fly   419 PGIMIGELFPARIRGRTAGGVFASMNVALFIFAKKF-PALQ---AMLKMRGVFLVFGVSSFLLTA 479
            ....:||.||.|::....|.:.....|...|...|| |..:   ......|:.:|.|:.:|    
  Fly   414 SSAYLGEAFPMRVKPFLIGLIVCLEQVIHIIVIVKFVPTAEFYYTYFVAVGIIMVIGLVAF---- 474

  Fly   480 FMCLFQPETKGRSLEHIEDYF 500
              .:..|||:|.:|....:.|
  Fly   475 --AVLMPETRGLTLRQAGERF 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4797NP_726368.2 MFS 64..484 CDD:119392 91/456 (20%)
Sugar_tr 89..497 CDD:278511 88/443 (20%)
CG17930NP_650533.1 Sugar_tr 102..493 CDD:278511 84/431 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.