DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4797 and Slc2a6

DIOPT Version :9

Sequence 1:NP_726368.2 Gene:CG4797 / 37770 FlyBaseID:FBgn0034909 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001100032.1 Gene:Slc2a6 / 296600 RGDID:1309317 Length:321 Species:Rattus norvegicus


Alignment Length:320 Identity:75/320 - (23%)
Similarity:130/320 - (40%) Gaps:41/320 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 MMYWRSVAWCANVLPLLSMVSISFIPETPAWLLRNGHEKRALQALSFLRG-SEISAQKELNDMKQ 273
            ::.||.:|.......|:.::.:||:|.:|.:||....::.|||||.:||. ||:..:.|......
  Rat     7 LLPWRWLAVAGEGPVLVMILLLSFMPNSPRFLLSKSRDEEALQALIWLRADSEVHWEFEQIQDNV 71

  Fly   274 RLAKERVTTKTNENIFQLCCQRVAIKPLVIVIVFSLLQMFSGTFIVIFYAVDMISEFGAEFDSKQ 338
            |....||:       :....:....:|::|.::...||..:|...::.|...:.........|:|
  Rat    72 RRQSSRVS-------WAEAWEPRVYRPILITVLMRFLQQLTGITPILVYLQTIFDSTSVVLPSQQ 129

  Fly   339 AAIATAVVRVICCMVFCV--------VLIFVRRRRIMIVSGIGSGLFCLVLSVYQYARFDQPKMS 395
            .|.....||::..::..|        ||::| ...||.|:.:..||:     |....|...|..:
  Rat   130 DAAIVGAVRLLSVLIAAVTMDLAGRKVLLYV-SASIMFVANLTLGLY-----VQLVPRTLTPNST 188

  Fly   396 YDVFVGAG------CLLGYI----IFNTALMVM---------PGIMIGELFPARIRGRTAGGVFA 441
            .::....|      ....|:    :..|.|.:|         ..:::.|:.|.|.||..:|....
  Rat   189 VEIVTLGGTEQPPAAAFNYLTLIPLLATMLFIMGYAMGWGPITWLLMSEVLPLRARGVASGLCVL 253

  Fly   442 SMNVALFIFAKKFPALQAMLKMRGVFLVFGVSSFLLTAFMCLFQPETKGRSLEHIEDYFN 501
            ...:..|:..|.|........::..|..|.....|...|.....|||:|||||.||.:|:
  Rat   254 VSWLTAFVLTKYFLLAVNAFGLQVPFFFFSAICLLSLLFTGCCVPETRGRSLEQIEAFFH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4797NP_726368.2 MFS 64..484 CDD:119392 64/301 (21%)
Sugar_tr 89..497 CDD:278511 72/314 (23%)
Slc2a6NP_001100032.1 MFS <89..293 CDD:119392 40/209 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.