DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4797 and F11D5.5

DIOPT Version :9

Sequence 1:NP_726368.2 Gene:CG4797 / 37770 FlyBaseID:FBgn0034909 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_508570.4 Gene:F11D5.5 / 184346 WormBaseID:WBGene00017382 Length:382 Species:Caenorhabditis elegans


Alignment Length:372 Identity:83/372 - (22%)
Similarity:149/372 - (40%) Gaps:96/372 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 VYIAETAEPNLRSLLIGAPYVAYSSGILMVYS------LGSMMYWRSVAWCANVLPLLSMVSISF 233
            ::|.|::..|.|.........|:....|:::|      ||:...|       .|.||..|:|.:.
 Worm     1 MFIVESSPDNCRGFASAFLIFAFVITKLVMFSVASPNLLGTSQVW-------FVFPLFGMISSTI 58

  Fly   234 I-------PETPAWLLRNGHEKRALQALSFLRGSEIS---------AQKELNDMKQRLAKERVTT 282
            :       ||:|.||::....:.|..::.|..|...:         .:|.|.|      |.|::.
 Worm    59 VFCFMVQLPESPKWLIQQDKVEEAKVSIRFYHGKNCTIHEVVTSFIKEKNLTD------KNRISL 117

  Fly   283 K---TNENIFQLCCQRVAIKPLVIVIVFSLLQM--FSGTFIVIFYAVDMISEFGAEFDSKQAAIA 342
            |   .||.:      |..:|     |||:||..  |..:::...|.:||....|  |..:||...
 Worm   118 KQIWDNETL------REGLK-----IVFALLLFLEFDTSYVTSVYTIDMHKSAG--FTVQQALNI 169

  Fly   343 TAVVRVICCMVFCVVLIF--------VRRRRIMIVSGI-----GSGLFCLVLSVYQYARFDQPKM 394
            ..::     .:|.:...|        :.||.|.:::.:     ...:|.|.:::|.:......::
 Worm   170 NLII-----TIFSLPTKFFGTFLSDSIGRRPIFVIAALLQYFRTCIIFSLEITIYIFGSSWLTRI 229

  Fly   395 SYDVFVGAGCLLGYIIFNTALMVMPGI------MIGELFPARIR---GRTAGGVFASMNVALFIF 450
            :|::          :.|..||:...|:      :..||||...|   |:|.  :.||:.:. |..
 Worm   230 TYNM----------VEFLAALVSATGVNSLRLLLTMELFPPSARTVIGQTQ--MIASILIG-FPI 281

  Fly   451 AKKFPALQAMLKMRGVFLV-FGVSSFLLTAFMCLFQPETKGRSLEHI 496
            ...||.:..|..  .:|.| |.::..||..::....|||:||::..|
 Worm   282 LSSFPIINTMFP--PIFFVPFVITQLLLGIYLFRHMPETRGRAVYDI 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4797NP_726368.2 MFS 64..484 CDD:119392 77/358 (22%)
Sugar_tr 89..497 CDD:278511 83/372 (22%)
F11D5.5NP_508570.4 Sugar_tr <1..326 CDD:278511 82/370 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.