DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4797 and SLC2A7

DIOPT Version :9

Sequence 1:NP_726368.2 Gene:CG4797 / 37770 FlyBaseID:FBgn0034909 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_011539126.1 Gene:SLC2A7 / 155184 HGNCID:13445 Length:517 Species:Homo sapiens


Alignment Length:378 Identity:110/378 - (29%)
Similarity:178/378 - (47%) Gaps:52/378 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 SWIASVHSLATPFGSLLSGPLADYLGRRRTL----ILSVIP-LLLGWSTLAIAKSIKVVIFARFL 161
            |...|:..|....||||.|.|.|..||:.||    |.::|| :|:|.|  .:||:.::::|:|.:
Human    78 SCTVSMFPLGGLLGSLLVGLLVDSCGRKGTLLINNIFAIIPAILMGVS--KVAKAFELIVFSRVV 140

  Fly   162 CGFATGILGGPGQVYIAETAEPNLRSLLIGAPYVAYSSGILM--VYS----LGSMMYWRSVAWCA 220
            .|...||......:|:.|.|..|||.::.....|....|:.:  ::|    ||:...|..:....
Human   141 LGVCAGISYSALPMYLGELAPKNLRGMVGTMTEVFVIVGVFLAQIFSLQAILGNPAGWPVLLALT 205

  Fly   221 NVLPLLSMVSISFIPETPAW-LLRNGHEKRALQALSFLRGSEISAQKELNDMKQRLAKERVTTKT 284
            .|..||.::::.|.||:|.: |::.|.|..|.|||..||| ....:.||.||:.....||  .:.
Human   206 GVPALLQLLTLPFFPESPRYSLIQKGDEATARQALRRLRG-HTDMEAELEDMRAEARAER--AEG 267

  Fly   285 NENIFQLCCQRVAIKPLVIVIVFSLLQMFSGTFIVIFYAVDMISEFGAE-FDSKQAAIATAVVRV 348
            :.::..||..|.....|:.:||....|..||...:.:||..:.:..|.| ..|:...:.:.||.:
Human   268 HLSVLHLCALRSLRWQLLSIIVLMAGQQLSGINAINYYADTIYTSAGVEAAHSQYVTVGSGVVNI 332

  Fly   349 ICCMVFCVVLIFVRRRRIMIVSGIG-SGLFCLVLSVYQYARFDQPKMSYDVFVGAGCLLGYI--- 409
            :..:...|::..:.||.::: :|.| .|..||||:|....:...|::||   :|..|:..||   
Human   333 VMTITSAVLVERLGRRHLLL-AGYGICGSACLVLTVVLLFQNRVPELSY---LGIICVFAYIAGH 393

  Fly   410 --------------IF-----NTALMV------MPGIMIGELFPARIRGRTAG 437
                          ||     ..|.||      :...:||.|||: |:|.|:|
Human   394 SIGPSPVPSVVRTEIFLQSSRRAAFMVDGAVHWLTNFIIGFLFPS-IQGPTSG 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4797NP_726368.2 MFS 64..484 CDD:119392 110/378 (29%)
Sugar_tr 89..497 CDD:278511 110/378 (29%)
SLC2A7XP_011539126.1 Sugar_tr 26..441 CDD:278511 107/372 (29%)
MFS 100..439 CDD:119392 97/348 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.