DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4797 and SLC2A12

DIOPT Version :9

Sequence 1:NP_726368.2 Gene:CG4797 / 37770 FlyBaseID:FBgn0034909 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_660159.1 Gene:SLC2A12 / 154091 HGNCID:18067 Length:617 Species:Homo sapiens


Alignment Length:539 Identity:118/539 - (21%)
Similarity:203/539 - (37%) Gaps:126/539 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 GCGM--------------PIGFSAILLPQLMDNNSTEIPIDVETGSWIASVHSLATPFGSLLSGP 121
            ||||              .:|:...::...:....|.:.:.......:.|...:.....||..|.
Human    35 GCGMFTFLSSVTAAVSGLLVGYELGIISGALLQIKTLLALSCHEQEMVVSSLVIGALLASLTGGV 99

  Fly   122 LADYLGRRRTLILSVIPLLLGWSTLAIAKSIKVVIFARFLCGFATGILGGPGQVYIAETAEPNLR 186
            |.|..|||..:|||...|.||...|.::.|..|:|..|...|.:..:......|||||.|..:.|
Human   100 LIDRYGRRTAIILSSCLLGLGSLVLILSLSYTVLIVGRIAIGVSISLSSIATCVYIAEIAPQHRR 164

  Fly   187 SLLIGAPYVAYSSGILMV----YSLGSMMY-WRSVAWCANVLPLLSMVSISFIPETPAWLLRNGH 246
            .||:....:....|||..    |:..::.: |:.:......|.:|..:::.|:|.:|.:|:..|.
Human   165 GLLVSLNELMIVIGILSAYISNYAFANVFHGWKYMFGLVIPLGVLQAIAMYFLPPSPRFLVMKGQ 229

  Fly   247 EKRALQALSFLRGSEISAQKELNDMKQRLAKERVTT-----KTNENIFQLCCQRVAIKPLVIVIV 306
            |..|.:.|..||... ...:||..:|..|..|...:     ::.:|:      |..|. :.:.:|
Human   230 EGAASKVLGRLRALS-DTTEELTVIKSSLKDEYQYSFWDLFRSKDNM------RTRIM-IGLTLV 286

  Fly   307 FSLLQMFSGTFIVIFYAVDMISEFGAEFDSKQAA----IATAVVRVICCMVFCVVLIFVRRR--- 364
            |.:  ..:|...::|||..::...|  |.|.:||    ....||:||..:...:::..|..:   
Human   287 FFV--QITGQPNILFYASTVLKSVG--FQSNEAASLASTGVGVVKVISTIPATLLVDHVGSKTFL 347

  Fly   365 ----RIMIVSGIGSGLFCLVL-----------------------------------------SVY 384
                .:|..|.:..|:..|.:                                         .:.
Human   348 CIGSSVMAASLVTMGIVNLNIHMNFTHICRSHNSINQSLDESVIYGPGNLSTNNNTLRDHFKGIS 412

  Fly   385 QYARFDQPKMSYDV----------FVGAG-------------------------CLLGYI-IFNT 413
            .::|.....:..||          .:.||                         .||.|: .|:.
Human   413 SHSRSSLMPLRNDVDKRGETTSASLLNAGLSHTEYQIVTDPGDVPAFLKWLSLASLLVYVAAFSI 477

  Fly   414 ALMVMPGIMIGELFPARIRGRTAGGVFASMNVAL-FIFAKKFPALQAMLKMRGVFLVFGVSSFLL 477
            .|..||.:::.|:||..|||| |..:.:|||..: .:.:..|..:..::.:..|..::.:.|...
Human   478 GLGPMPWLVLSEIFPGGIRGR-AMALTSSMNWGINLLISLTFLTVTDLIGLPWVCFIYTIMSLAS 541

  Fly   478 TAFMCLFQPETKGRSLEHI 496
            ..|:.:|.|||||.|||.|
Human   542 LLFVVMFIPETKGCSLEQI 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4797NP_726368.2 MFS 64..484 CDD:119392 108/525 (21%)
Sugar_tr 89..497 CDD:278511 113/507 (22%)
SLC2A12NP_660159.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Sugar_tr 44..561 CDD:306568 114/530 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.