DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4797 and LOC101882789

DIOPT Version :9

Sequence 1:NP_726368.2 Gene:CG4797 / 37770 FlyBaseID:FBgn0034909 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_021331508.1 Gene:LOC101882789 / 101882789 -ID:- Length:181 Species:Danio rerio


Alignment Length:133 Identity:38/133 - (28%)
Similarity:70/133 - (52%) Gaps:8/133 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 IKVVIFARFLCGFATGILGGPGQVYIAETAEPNLRSLLIGAPYVAYSSGILMVYSL-GSMMYWRS 215
            :|.:||..:: ....||......||||||:.|:||..|:....:..::|......: |:..|.:.
Zfish     3 VKELIFDCWM-SICAGIASMTVPVYIAETSPPHLRGRLVTINTLFITAGQFTASVIDGAFSYMKH 66

  Fly   216 VAW----CANVLP-LLSMVSISFIPETPAWLLRNGHEKRALQALSFLRGSEISAQKELNDMKQRL 275
            ..|    ..:|:| ||..:...|:||:|.||::.|..::|.:.||.:||:: :..:|.:.:|..:
Zfish    67 EGWRYMLGLSVIPALLQFLGFLFLPESPRWLIQKGLTQKARRVLSQIRGNQ-NIDEEYDTIKSSI 130

  Fly   276 AKE 278
            .:|
Zfish   131 EEE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4797NP_726368.2 MFS 64..484 CDD:119392 38/133 (29%)
Sugar_tr 89..497 CDD:278511 38/133 (29%)
LOC101882789XP_021331508.1 Sugar_tr <14..>135 CDD:331684 35/121 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.