DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and NTF2

DIOPT Version :9

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_010925.1 Gene:NTF2 / 856727 SGDID:S000000811 Length:125 Species:Saccharomyces cerevisiae


Alignment Length:118 Identity:34/118 - (28%)
Similarity:58/118 - (49%) Gaps:8/118 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELP--SSNHQLNTLDAQP 78
            |..||:.||...|..|.|:|.||.:.:.|::..:...|.:.|......||  ...|::.||||||
Yeast     9 AQNFTQFYYNQFDTDRSQLGNLYRNESMLTFETSQLQGAKDIVEKLVSLPFQKVQHRITTLDAQP 73

  Fly    79 IVDQAVSNQLAYLIMASGSVKFADQQ-LRKFQQTFIVTAENDKWKVVSDCYRM 130
                 .|.....|:|.:|.:...::| .::|.|.|.:..:.:.:.|.:|.:|:
Yeast    74 -----ASPNGDVLVMITGDLLIDEEQNPQRFSQVFHLIPDGNSYYVFNDIFRL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 34/118 (29%)
NTF2NP_010925.1 NTF2 4..123 CDD:238403 34/118 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.