DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and NTF2B

DIOPT Version :9

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001077612.1 Gene:NTF2B / 839690 AraportID:AT1G27970 Length:134 Species:Arabidopsis thaliana


Alignment Length:139 Identity:35/139 - (25%)
Similarity:61/139 - (43%) Gaps:20/139 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSDLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELP 65
            ||.|..:|         .|...||::.|..|..:..||.:.:.|::.|....|.|.|.:....||
plant     4 MDPDAVSK---------AFVEHYYSTFDTNRVGLAGLYQEASMLTFEGQKIQGVQSIVAKLTSLP 59

  Fly    66 --SSNHQLNTLDAQPIVDQAVSNQLAYLIMASGSVKFA-DQQLRKFQQTF-IVTAENDKWKVVSD 126
              ...|.::|:|.||....:     ..|:..||:::.| ::...||.|.| ::......:.|.:|
plant    60 FQQCKHHISTVDCQPSGPAS-----GMLVFVSGNLQLAGEEHALKFSQMFHLMPTPQGSFYVFND 119

  Fly   127 CY--RMQEV 133
            .:  |:.:|
plant   120 IFSWRLLQV 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 30/126 (24%)
NTF2BNP_001077612.1 NTF2 5..121 CDD:238403 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12612
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.