DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and NTF2A

DIOPT Version :9

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_174051.1 Gene:NTF2A / 839620 AraportID:AT1G27310 Length:122 Species:Arabidopsis thaliana


Alignment Length:133 Identity:36/133 - (27%)
Similarity:57/133 - (42%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSDLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELP 65
            ||.|..||         .|...||::.|..|..:..||.:.:.|::.|....|.|.|.:....||
plant     1 MDPDAVAK---------AFVEHYYSTFDANRPGLVSLYQEGSMLTFEGQKIQGSQNIVAKLTGLP 56

  Fly    66 --SSNHQLNTLDAQPIVDQAVSNQLAYLIMASGSVKFA-DQQLRKFQQTFIVTAENDKWKVVSDC 127
              ...|.:.|:|.||.....     ..|:..||:::.| :|...||.|.|.:.:....:.|.:|.
plant    57 FQQCKHNITTVDCQPSGPAG-----GMLVFVSGNLQLAGEQHALKFSQMFHLISNQGNYYVFNDI 116

  Fly   128 YRM 130
            :|:
plant   117 FRL 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 31/123 (25%)
NTF2ANP_174051.1 NTF2 2..121 CDD:238403 35/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12612
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.