DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and Ntf-2

DIOPT Version :9

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001259750.1 Gene:Ntf-2 / 33078 FlyBaseID:FBgn0031145 Length:130 Species:Drosophila melanogaster


Alignment Length:117 Identity:29/117 - (24%)
Similarity:46/117 - (39%) Gaps:11/117 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FTRLYYASVD---NRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQEL--PSSNHQLNTLDAQP 78
            |.:.|||..|   ||...:......::.:::.|:...|...|....|.|  ......:.|:|:||
  Fly    14 FVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQGAPKILEKVQSLSFQKITRVITTVDSQP 78

  Fly    79 IVDQAVSNQLAYLIMASGSVKFADQQLRKFQQTFIVTAENDKWKVVSDCYRM 130
            ..|..|      ||...|.::..|.....|.|.|.:.|....:.|..|.:|:
  Fly    79 TFDGGV------LINVLGRLQCDDDPPHAFSQVFFLKANAGTFFVAHDIFRL 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 29/117 (25%)
Ntf-2NP_001259750.1 NTF2 6..125 CDD:238403 29/117 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467848
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.