DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and Nxt1

DIOPT Version :9

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001099991.1 Gene:Nxt1 / 296219 RGDID:1309327 Length:140 Species:Rattus norvegicus


Alignment Length:133 Identity:56/133 - (42%)
Similarity:83/133 - (62%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELPSSN 68
            |.|..|:...|.|:.|..:||.::||||:.:.|||:..|||.||||...|::.:..:|:.||||.
  Rat     5 DFKTYVDQACRAAEEFVNVYYTTMDNRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSE 69

  Fly    69 HQLNTLDAQPIVDQAVSNQLAYLIMASGSVKFADQQLRKFQQTFIVTAE----NDKWKVVSDCYR 129
            .|:|.:|.||:.|:|..:|...|::..|:|||...:.|.|.|.||:||:    |..||:.|||:|
  Rat    70 FQINVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFR 134

  Fly   130 MQE 132
            .|:
  Rat   135 FQD 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 52/124 (42%)
Nxt1NP_001099991.1 NTF2 12..137 CDD:238403 53/126 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352091
Domainoid 1 1.000 115 1.000 Domainoid score I5882
eggNOG 1 0.900 - - E1_KOG4353
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8301
Inparanoid 1 1.050 125 1.000 Inparanoid score I4614
OMA 1 1.010 - - QHG56125
OrthoDB 1 1.010 - - D1450028at2759
OrthoFinder 1 1.000 - - FOG0004415
OrthoInspector 1 1.000 - - otm44677
orthoMCL 1 0.900 - - OOG6_104429
Panther 1 1.100 - - O PTHR12612
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4218
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.