DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and NXT1

DIOPT Version :9

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_037380.1 Gene:NXT1 / 29107 HGNCID:15913 Length:140 Species:Homo sapiens


Alignment Length:133 Identity:55/133 - (41%)
Similarity:82/133 - (61%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELPSSN 68
            |.|..|:...|.|:.|..:||.::|.||:.:.|||:..|||.||||...|::.:..:|:.||||.
Human     5 DFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSEFFEMLPSSE 69

  Fly    69 HQLNTLDAQPIVDQAVSNQLAYLIMASGSVKFADQQLRKFQQTFIVTAE----NDKWKVVSDCYR 129
            .|::.:|.||:.|:|..:|...|::..|||||...:.|.|.|.||:||:    |..||:.|||:|
Human    70 FQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFR 134

  Fly   130 MQE 132
            .|:
Human   135 FQD 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 51/124 (41%)
NXT1NP_037380.1 NTF2 12..137 CDD:238403 51/124 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158108
Domainoid 1 1.000 113 1.000 Domainoid score I6137
eggNOG 1 0.900 - - E1_KOG4353
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8301
Inparanoid 1 1.050 123 1.000 Inparanoid score I4738
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56125
OrthoDB 1 1.010 - - D1450028at2759
OrthoFinder 1 1.000 - - FOG0004415
OrthoInspector 1 1.000 - - otm40539
orthoMCL 1 0.900 - - OOG6_104429
Panther 1 1.100 - - O PTHR12612
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2697
SonicParanoid 1 1.000 - - X4218
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.