DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and nxt1

DIOPT Version :9

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_593517.2 Gene:nxt1 / 2543644 PomBaseID:SPAPB1A10.03 Length:115 Species:Schizosaccharomyces pombe


Alignment Length:94 Identity:29/94 - (30%)
Similarity:48/94 - (51%) Gaps:9/94 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIE--SYFQELPSSNHQL 71
            :||..:.|..|.:.||:|:|..|..|...|.:|:.:.|||.   ..|:.|  |....||.|..::
pombe     1 MESSVKYAQEFVQRYYSSLDTNRNGIAEFYRENSLILWNGK---PMQVTEFTSMIVNLPYSKTKV 62

  Fly    72 NTLDAQPIVDQAVSNQLAYLIMASGSVKF 100
            ...|:|    |.:.|.:..:|:.||:::|
pombe    63 EDFDSQ----QVMGNDMNIIIVVSGTIRF 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 28/92 (30%)
nxt1NP_593517.2 NTF2 3..109 CDD:238403 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4353
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004415
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104429
Panther 1 1.100 - - LDO PTHR12612
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2697
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.