DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and Nxt2

DIOPT Version :9

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001277461.1 Gene:Nxt2 / 237082 MGIID:2147914 Length:198 Species:Mus musculus


Alignment Length:133 Identity:55/133 - (41%)
Similarity:80/133 - (60%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELPSSN 68
            :.|..|:...|.|:.|..:||.::|.||..:.|||||.|||.||||...|.:.:.::|:.||||.
Mouse    62 NFKTYVDQACRAAEEFVNIYYETMDKRRHALVRLYLDKATLIWNGNVVTGLEALANFFEMLPSSE 126

  Fly    69 HQLNTLDAQPIVDQAVSNQLAYLIMASGSVKFADQQLRKFQQTFIVTAENDK----WKVVSDCYR 129
            .|:|.||.||:.:||...|...|::.||.|||...:...|.|.|::||::..    ||:.|||:|
Mouse   127 FQINMLDCQPVHEQATQCQTTVLVVTSGVVKFDGNKQHFFNQNFLLTAQSTPNSTVWKIASDCFR 191

  Fly   130 MQE 132
            .|:
Mouse   192 FQD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 52/124 (42%)
Nxt2NP_001277461.1 NTF2 69..194 CDD:238403 52/124 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848492
Domainoid 1 1.000 110 1.000 Domainoid score I6318
eggNOG 1 0.900 - - E1_KOG4353
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4761
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56125
OrthoDB 1 1.010 - - D1450028at2759
OrthoFinder 1 1.000 - - FOG0004415
OrthoInspector 1 1.000 - - otm42610
orthoMCL 1 0.900 - - OOG6_104429
Panther 1 1.100 - - LDO PTHR12612
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2697
SonicParanoid 1 1.000 - - X4218
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.