DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nxt1 and nxt2

DIOPT Version :9

Sequence 1:NP_611833.1 Gene:Nxt1 / 37769 FlyBaseID:FBgn0028411 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001120133.1 Gene:nxt2 / 100145163 XenbaseID:XB-GENE-5823504 Length:140 Species:Xenopus tropicalis


Alignment Length:136 Identity:54/136 - (39%)
Similarity:78/136 - (57%) Gaps:4/136 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSDLKAKVESCARTADTFTRLYYASVDNRRQQIGRLYLDNATLSWNGNGAIGRQMIESYFQELP 65
            :.||.:..|:...|.|:.|..|||.::|.||:|:.:||.|.|||.||||...|:..:..:|:.||
 Frog     2 VSSDFRTDVDLACRAAEEFVNLYYETIDKRRRQLIKLYTDTATLVWNGNPISGQDSLVEFFEMLP 66

  Fly    66 SSNHQLNTLDAQPIVDQAVSNQLAYLIMASGSVKFADQQLRKFQQTFIV----TAENDKWKVVSD 126
            ||..|:|..|..|:.:||...|...|::|.|.|||...:...|.|.|::    |..|..||:.||
 Frog    67 SSEFQVNMFDCHPVHEQATQGQKTVLVVAHGIVKFEGNKHHYFNQNFLLSLHATPTNSVWKIASD 131

  Fly   127 CYRMQE 132
            |:|.|:
 Frog   132 CFRFQD 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nxt1NP_611833.1 NTF2 11..132 CDD:238403 50/124 (40%)
nxt2NP_001120133.1 NTF2 13..137 CDD:238403 50/123 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 104 1.000 Domainoid score I6658
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4715
OMA 1 1.010 - - QHG56125
OrthoDB 1 1.010 - - D1450028at2759
OrthoFinder 1 1.000 - - FOG0004415
OrthoInspector 1 1.000 - - oto102602
Panther 1 1.100 - - LDO PTHR12612
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2697
SonicParanoid 1 1.000 - - X4218
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.