DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and SNRNP40

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_004805.2 Gene:SNRNP40 / 9410 HGNCID:30857 Length:357 Species:Homo sapiens


Alignment Length:307 Identity:70/307 - (22%)
Similarity:125/307 - (40%) Gaps:61/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 PSGARLVSGSIDYDMCFWDFAGMDSSMRSFRQLQPCENH--------PIRSLQYSVTGDMILVIS 248
            |:|:.|.|...|..:..|:..|            .|:|:        .:..|.|:..|.|:...|
Human    76 PNGSTLASAGFDRLILLWNVYG------------DCDNYATLKGHSGAVMELHYNTDGSMLFSAS 128

  Fly   249 GNAQAKVLDRDGFEKLECCKGDQYISDMSRTKGHVAQLTSGCWHPFNR--EQFLTAALDGTLRIW 311
            .:....|.|.:..|:::            |.|||.:.:.| | :|..|  :...|.:.|||:::|
Human   129 TDKTVAVWDSETGERVK------------RLKGHTSFVNS-C-YPARRGPQLVCTGSDDGTVKLW 179

  Fly   312 QGLKSKEQLQVIKTRAQGGLRTNAASCNFNRDATLIAAGCVDGSIQTWDTRKMFVNTTHCVRDAH 376
            . ::.|..:|..:...|      ..:..||..:..|.:|.:|..|:.||.|:.  ..|:.:| .|
Human   180 D-IRKKAAIQTFQNTYQ------VLAVTFNDTSDQIISGGIDNDIKVWDLRQN--KLTYTMR-GH 234

  Fly   377 QKGSEITSIVFSYMGQQLATRSNDETMKLWDLRQFKQPLHTWTNLFS------RYDTTDCCFSPD 435
              ...:|.:..|..|..|.:.:.|.|:::||:|.| .|......:|.      ..:...|.:|||
Human   235 --ADSVTGLSLSSEGSYLLSNAMDNTVRVWDVRPF-APKERCVKIFQGNVHNFEKNLLRCSWSPD 296

  Fly   436 DRLLVTGESLPKGQAEANLYFYSTKSYEEVQRIPVSNAHVVKTLWHP 482
                  |..:..|.|:..:|.:.|.|...:.::|.....:.:..:||
Human   297 ------GSKIAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 70/307 (23%)
WD40 180..497 CDD:295369 70/307 (23%)
WD40 repeat 185..227 CDD:293791 7/34 (21%)
WD40 repeat 233..268 CDD:293791 8/34 (24%)
WD40 repeat 273..329 CDD:293791 15/57 (26%)
WD40 repeat 337..374 CDD:293791 10/36 (28%)
WD40 repeat 382..419 CDD:293791 11/36 (31%)
WD40 repeat 427..469 CDD:293791 10/41 (24%)
WD40 repeat 475..497 CDD:293791 2/8 (25%)
SNRNP40NP_004805.2 WD40 62..351 CDD:238121 70/307 (23%)
WD 1 64..103 9/38 (24%)
WD40 repeat 70..107 CDD:293791 9/42 (21%)
WD 2 107..146 8/50 (16%)
WD40 repeat 112..148 CDD:293791 9/47 (19%)
WD 3 149..189 12/42 (29%)
WD40 repeat 155..190 CDD:293791 11/37 (30%)
WD 4 191..230 11/46 (24%)
WD40 repeat 196..232 CDD:293791 10/37 (27%)
WD 5 233..272 12/41 (29%)
WD40 repeat 238..278 CDD:293791 11/40 (28%)
WD 6 283..322 10/44 (23%)
WD40 repeat 288..312 CDD:293791 8/29 (28%)
WD 7 325..357 2/13 (15%)
WD40 repeat 330..352 CDD:293791 2/8 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.