DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and PAN2

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_011421.1 Gene:PAN2 / 852786 SGDID:S000003062 Length:1115 Species:Saccharomyces cerevisiae


Alignment Length:313 Identity:69/313 - (22%)
Similarity:104/313 - (33%) Gaps:90/313 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 NFNRDATLIAAGCVDGSIQTWD-TRKMFVNTTHCVRDAHQKGSEITSIVFSYMGQQLATRSNDET 402
            :|:..|.||.:|...|.|.::| |.:::....     .|..|:.:..|:....|  :.:.|.|. 
Yeast    36 SFDEKANLIWSGDSYGCISSYDPTFQLYTRYR-----GHIGGNSVKDILSHRDG--ILSISEDS- 92

  Fly   403 MKLWDLRQFKQPLH-------TWTNL-------FSRYDTTDCCFSP---DDRLLVTGESLPKGQA 450
                        ||       |..||       ||..:|  .|:||   .:.:...|::...|.|
Yeast    93 ------------LHFANRRGVTKLNLTSIDIAAFSELNT--MCYSPHSLKNNIYCGGDNTNWGIA 143

  Fly   451 EANL---YFYSTKSYEEVQRIPVSNAHVVKTLWHPKLNQLFVSCGNGTIKCYYDEHRSIRGAKLC 512
            ..:|   ...|..:|....::..||..|:..........|.....|.|||.:.....||....| 
Yeast   144 SIDLNRGCLDSLLNYSSKVKLMCSNNKVLSIGRQTGTVDLLDPTSNRTIKSFNAHSASISAMDL- 207

  Fly   513 VVKTHRKRQPMEMVGVS-QIITPHALPLFRQEKSRTSRKRMEKARMDPVKSQRPDLPITSGQGGR 576
                  :...:..||.| :....:|.|.......||.|      ::.||...:   ..|.|.||.
Yeast   208 ------RDNTLVTVGKSKRFYNLYADPFVNVYDLRTMR------QLPPVSFSK---GTTMGSGGA 257

  Fly   577 --------------VASSGGTL-----------SSYV-----IRNLGLSKRVD 599
                          ||||.|:.           :.||     |:.|.||...|
Yeast   258 DFVQLHPLLPTVMIVASSSGSFDFIDLSNPTLRTQYVHPCQSIKKLCLSPNGD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 43/200 (22%)
WD40 180..497 CDD:295369 38/178 (21%)
WD40 repeat 185..227 CDD:293791
WD40 repeat 233..268 CDD:293791
WD40 repeat 273..329 CDD:293791
WD40 repeat 337..374 CDD:293791 9/35 (26%)
WD40 repeat 382..419 CDD:293791 7/43 (16%)
WD40 repeat 427..469 CDD:293791 10/47 (21%)
WD40 repeat 475..497 CDD:293791 4/21 (19%)
PAN2NP_011421.1 WD40 <15..352 CDD:225201 69/313 (22%)
UCH_1 505..829 CDD:404327
PAN2_exo 907..1080 CDD:99846
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.