DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and MAC3A

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001030958.1 Gene:MAC3A / 839503 AraportID:AT1G04510 Length:523 Species:Arabidopsis thaliana


Alignment Length:291 Identity:69/291 - (23%)
Similarity:111/291 - (38%) Gaps:61/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 LVSGSIDYDMCFWDFAGMDSSMRSFRQLQPCENHPIRSLQYSVTGDMILVISGNAQAKVLDRDGF 261
            :.:|.||.....:|       ..|.:.|.....|..:.......||..||::.::...|      
plant   237 IATGGIDTTAVLFD-------RPSGQILSTLTGHSKKVTSIKFVGDTDLVLTASSDKTV------ 288

  Fly   262 EKLECCKGDQYISDMSRTKGHVAQLTSGCWHPFNREQFLTAALDGTLRIW--QGLKSKEQLQVIK 324
             ::..|..|...:.....|.|.|::.:...|..|: .|::|:||.|   |  ..|.|...|..:.
plant   289 -RIWGCSEDGNYTSRHTLKDHSAEVRAVTVHATNK-YFVSASLDST---WCFYDLSSGLCLAQVT 348

  Fly   325 TRAQGGLRTNAASCNFNRDATLIAAGCVDGSIQTWDTRKMFVNTTHCVRDAHQKGSEITSIVFSY 389
            ..::..:...||:  |:.|..::..|.....::.||.:    :..:..:.....| |||||.||.
plant   349 DASENDVNYTAAA--FHPDGLILGTGTAQSIVKIWDVK----SQANVAKFGGHNG-EITSISFSE 406

  Fly   390 MGQQLATRSNDETMKLWDLRQFKQPLHTWTNLFSRYDTTDCCFSPDDRLLVTGESLPKGQAEAN- 453
            .|..|||.:.| .::|||||:.|.        |..:|..|                      || 
plant   407 NGYFLATAALD-GVRLWDLRKLKN--------FRTFDFPD----------------------ANS 440

  Fly   454 LYFYSTKSYEEV--QRIPVSNAHVVKTLWHP 482
            :.|..:.||..:  ..|.|..|..||..|:|
plant   441 VEFDHSGSYLGIAASDIRVFQAASVKAEWNP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 69/291 (24%)
WD40 180..497 CDD:295369 69/291 (24%)
WD40 repeat 185..227 CDD:293791 6/29 (21%)
WD40 repeat 233..268 CDD:293791 5/34 (15%)
WD40 repeat 273..329 CDD:293791 14/57 (25%)
WD40 repeat 337..374 CDD:293791 5/36 (14%)
WD40 repeat 382..419 CDD:293791 17/36 (47%)
WD40 repeat 427..469 CDD:293791 6/44 (14%)
WD40 repeat 475..497 CDD:293791 4/8 (50%)
MAC3ANP_001030958.1 Ubox 1..65 CDD:128780
Prp19 67..130 CDD:285771
WD40 213..>508 CDD:225201 69/291 (24%)
WD40 224..508 CDD:238121 69/291 (24%)
WD40 repeat 225..262 CDD:293791 6/31 (19%)
WD40 repeat 268..307 CDD:293791 7/45 (16%)
WD40 repeat 312..348 CDD:293791 11/39 (28%)
WD40 repeat 358..393 CDD:293791 7/40 (18%)
WD40 repeat 399..434 CDD:293791 18/43 (42%)
WD40 repeat 439..476 CDD:293791 11/33 (33%)
WD40 repeat 484..508 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.